KEGG   Ciona intestinalis (sea squirt): 100177147Help
Entry
100177147         CDS       T01056                                 

Definition
3-hydroxyisobutyryl-CoA hydrolase, mitochondrial-like
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:cin01200]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:cin00640]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:cin00280]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:cin00410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
9
AA seq 400 aa AA seqDB search
MMNCAKSIRRVLVLSKHIQGAQVSSPVSSISKMRLARCFSSASFAGDDVLFERIGGAGII
TLNRPSALNALNLSMIKKIFPKIKEWEEDPATTMIIMKGAGGKAFCAGGDILSITEEGKK
GNYEAGQEFFRSEYQLNYRIATCLVPYIAFIDGITMGGGVGLSVHGENRICTERTLFAMP
ETAIGLFPDVGGSYFLPRLSKHLGMYLALTGFRLKGRDVYKAGVATRMVHSTVLPQLEQD
LVAMENPSTQDITDLLRKYHEECQTGRERDYLILRDKEEDIKRMFCADSVEEIFENLRND
GSEWALEQLSVMEKMSPTSLKITHRQLSLGESLDLSECLEMEYRMGSQCLRHPDFYEGVR
SVLIDKDKSPKWNPATLSGVTEGIVDKHFILPSDGEELQL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgatgaattgtgcaaaaagtattcgaagagttctggtcttatctaaacatatccaagga
gctcaggtttcatctcctgtctcatcgatcagcaaaatgcgactagcaaggtgtttctct
tcagcctcttttgcaggagacgatgttttgtttgaacgtattggtggagctggaattata
actctgaacaggccatcagcattaaatgctttaaatctgtctatgataaaaaaaatattt
ccaaaaattaaggaatgggaagaagacccagctactacaatgattataatgaaaggtgca
ggtggtaaagctttctgtgctggtggtgatattctatcaataaccgaggagggaaaaaag
ggaaactatgaagcaggtcaagagttttttcgttctgaatatcagttgaattacagaata
gcgacgtgccttgttccttacattgcatttattgatggaataacaatggggggtggtgta
ggattgtcggttcatggtgaaaacaggatttgcaccgaacgtactttgtttgcaatgcct
gaaactgcaataggtcttttccctgatgttggaggttcctacttcctgccacgactaagc
aaacatcttggaatgtatcttgctttgacgggcttccgactgaaaggcagagatgtttac
aaagcaggtgtagctacacgtatggttcatagtaccgtcctacctcaacttgaacaagat
cttgttgcaatggagaatccatccacacaggatataacagacttacttcgtaaatatcat
gaagaatgtcaaactgggagggaacgagattatctcatccttcgtgataaagaagaagac
ataaagaggatgttttgtgccgattctgtggaagaaatttttgagaatttaaggaatgat
ggaagtgagtgggcacttgaacaactcagtgtgatggaaaaaatgtcgcctacttcgtta
aagatcacccacagacaactaagtcttggggaaagtcttgatctgagtgagtgtttggaa
atggaatacaggatgggcagccaatgtttgagacatcctgacttttatgagggggttcgt
tccgttcttattgacaaagataaatcaccgaagtggaacccagctactttgtctggtgta
acggagggtattgtagacaagcacttcatactgccctctgatggtgaagagttgcaactg
taa

DBGET integrated database retrieval system