KEGG   Ciona intestinalis (sea squirt): 100177164Help
Entry
100177164         CDS       T01056                                 

Definition
cationic trypsin-like
Orthology
K01312  
trypsin [EC:3.4.21.4]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:cin00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100177164
Enzymes [BR:cin01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     100177164
Peptidases [BR:cin01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100177164
Exosome [BR:cin04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100177164
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 245 aa AA seqDB search
MKVFILALLVAAAVADDDKIIGGQLTSPGDLPYIVNLKRFGSLMCGGSILSANWAMSAAH
CNAAAASLTVTAGDYSLSNNDGTEQASSVVRTVPHPQYNSNTMENDIMLLQLSSSISQNS
HVTFATLPAAFNDPAVGTVCKVSGWGNTQIVGSNYPDKPYSVQVPIISNSDCNNAYGGGI
YDGMMCLGLLGTGGKDSCQGDSGGPVVCNGAVHGVVSWGIGCAYPDYPGVYTRVSHYISF
INSYV
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcttcattctcgcactcttggtagcagcagctgtcgctgacgatgacaaaatc
atcggagggcaactcaccagccccggtgacttgccatacatcgtcaacttgaagagattt
ggaagccttatgtgcggaggaagcatcctcagcgctaactgggccatgtccgccgctcac
tgcaacgccgccgccgcttcccttactgttactgctggagactacagcctttccaacaat
gacggtaccgagcaagcatccagtgttgtaaggaccgtaccccacccacagtacaacagt
aacaccatggaaaacgacatcatgttgcttcaactctcaagcagcatcagccagaactcc
cacgttacattcgccaccctcccagccgcattcaacgacccagccgtaggaactgtctgc
aaagtatctggatggggaaacacccagattgttggatccaactaccccgacaagccatac
agtgtacaagtaccaatcatctccaactctgactgcaacaacgcatacggtggagggatc
tatgatggtatgatgtgccttggattgttgggaactggaggaaaagactcttgccaaggt
gattccggcggcccagtcgtttgcaacggtgctgttcacggtgtcgtatcttggggcatt
ggatgcgcctacccagactacccaggtgtttacaccagagtgtctcactacatcagcttc
atcaactcctacgtttaa

DBGET integrated database retrieval system