KEGG   Ciona intestinalis (sea squirt): 100177164Help
Entry
100177164         CDS       T01056                                 

Definition
cationic trypsin-like
Orthology
K01312  
trypsin [EC:3.4.21.4]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Neuroactive ligand-receptor interaction
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:cin04080]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 245 aa AA seqDB search
MKVFILALLVAAAVADDDKIIGGQLTSPGDLPYIVNLKRFGSLMCGGSILSANWAMSAAH
CNAAAASLTVTAGDYSLSNNDGTEQASSVVRTVPHPQYNSNTMENDIMLLQLSSSISQNS
HVTFATLPAAFNDPAVGTVCKVSGWGNTQIVGSNYPDKPYSVQVPIISNSDCNNAYGGGI
YDGMMCLGLLGTGGKDSCQGDSGGPVVCNGAVHGVVSWGIGCAYPDYPGVYTRVSHYISF
INSYV
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcttcattctcgcactcttggtagcagcagctgtcgctgacgatgacaaaatc
atcggagggcaactcaccagccccggtgacttgccatacatcgtcaacttgaagagattt
ggaagccttatgtgcggaggaagcatcctcagcgctaactgggccatgtccgccgctcac
tgcaacgccgccgccgcttcccttactgttactgctggagactacagcctttccaacaat
gacggtaccgagcaagcatccagtgttgtaaggaccgtaccccacccacagtacaacagt
aacaccatggaaaacgacatcatgttgcttcaactctcaagcagcatcagccagaactcc
cacgttacattcgccaccctcccagccgcattcaacgacccagccgtaggaactgtctgc
aaagtatctggatggggaaacacccagattgttggatccaactaccccgacaagccatac
agtgtacaagtaccaatcatctccaactctgactgcaacaacgcatacggtggagggatc
tatgatggtatgatgtgccttggattgttgggaactggaggaaaagactcttgccaaggt
gattccggcggcccagtcgtttgcaacggtgctgttcacggtgtcgtatcttggggcatt
ggatgcgcctacccagactacccaggtgtttacaccagagtgtctcactacatcagcttc
atcaactcctacgtttaa

DBGET integrated database retrieval system