KEGG   Ciona intestinalis (sea squirt): 100177168Help
Entry
100177168         CDS       T01056                                 

Definition
ubiquitin carboxyl-terminal hydrolase 45-like
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.4.19.12]
Organism
cin  Ciona intestinalis (sea squirt)
Brite
Enzymes [BR:cin01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100177168
Peptidases [BR:cin01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100177168
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
12
AA seq 488 aa AA seqDB search
MVKKRVKQRRINNKQNGGNVKSGKIVEYEVDKDGGGEGDAKVCEDSNEPEVTLNLPPPIG
LHNLGNTCFFNSVLQSLSQTPVLSTVVKLHIKQTLDKIEQEVSTSSQPTLKYTLDKLGPM
TTAFSNFFDGIKVSNTMSTLNKRPTRTKSISPKNLFNQLCNKNAKFRGYQQQDSQEFFHC
LLESLKQEEIKQRKGGILHALGLYNSKAKDVSDDELKKVRGYGVQITEKTPTFVESVFGG
KLISCVQCDECKMVTKVTESFVDISLPVIEEQTSRGAMQRRKGVDKEEADQQNNSKTPLS
KHALKKMKKQRKQARRAKPTNQDISDVTIGIDDAVGTLANQVAEMVLSDAMMSLKLFHEE
DVLQVRGGSIDVASLNIPEEEEESPEDQSEEEDQLDETTSDKDSTEDEMLKPTRNQKVNS
LFDTPMKKVTPKKSRQIPDLLGHRFQPASEECSVQSCFHQFTKPEILTGSNKFGCEVCTN
KQKSTDGK
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagaaacgggtgaagcaacgcaggattaacaataagcagaatggagggaatgtt
aaaagtgggaagattgtggaatatgaagtagataaagatgggggtggtgagggagatgct
aaagtttgtgaagattcaaatgaacctgaagtaacactaaacctccccccacccattggt
ttacataaccttggcaacacttgtttctttaacagcgttttgcagtcactaagtcaaact
cctgtgctttcaaccgtcgtcaaacttcacataaaacaaactttggataaaattgaacaa
gaagtttccacttcttcccaaccgacgttaaaatatactttggataagttgggaccaatg
acaactgccttttcgaacttctttgatggaattaaagtttcaaacacgatgtcaactcta
aataaacgaccaacaagaacgaaatctatttcaccaaagaatctgttcaatcaactgtgt
aacaaaaatgcaaagttccggggttaccaacagcaagatagtcaggaattcttccattgt
ttgcttgaatcgctgaaacaagaagaaataaaacaaagaaaaggtggaatactacacgca
cttggtctttataattccaaagcaaaagatgtttctgatgatgagttaaagaaagtgcga
gggtacggggttcaaatcaccgagaaaacgccaacatttgttgaaagtgtgtttggtgga
aaacttattagttgcgttcaatgtgatgaatgtaaaatggtaaccaaggtaacggaatcg
tttgttgatatttctcttcctgtaattgaggaacaaacatcacgaggagcgatgcagagg
aggaagggggttgataaagaggaggcagatcaacagaataattcgaagactccattaagc
aaacacgctttaaaaaaaatgaaaaaacaaagaaaacaagctcgtcgtgcaaaaccaacc
aaccaggacattagtgatgtcacaatagggattgatgatgctgtcggtacattagccaat
caggtggcagagatggtgttgtctgatgccatgatgtcactcaagttgtttcatgaggag
gatgtgttacaggtccgtggaggatccatagatgtggcatctcttaatatccctgaggag
gaagaagaaagtccggaggatcaaagtgaagaagaagatcaattggatgaaactacatcc
gataaagattcaactgaagatgaaatgttgaaaccaacaaggaatcaaaaagtaaactca
ctcttcgataccccaatgaagaaagttactccgaagaaaagtcgacaaatccctgattta
ctcggacatcggtttcaacctgctagtgaggaatgctccgtacaatcttgtttccaccaa
ttcactaaaccagaaattttgaccgggtcaaataagtttggttgtgaagtttgtacgaac
aaacaaaagtcaacggatggtaagtaa

DBGET integrated database retrieval system