KEGG   Ciona intestinalis (sea squirt): 100177333Help
Entry
100177333         CDS       T01056                                 

Definition
(RefSeq) protein disulfide-isomerase A5
  KO
K09583  protein disulfide isomerase family A, member 5 [EC:5.3.4.1]
Organism
cin  Ciona intestinalis (sea squirt)
Brite
Enzymes [BR:cin01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100177333
Chaperones and folding catalysts [BR:cin03110]
 Protein folding catalysts
  Protein disulfide isomerase
   100177333
Membrane trafficking [BR:cin04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    100177333
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_2 Thioredoxin_7 OST3_OST6 AhpC-TSA Thioredoxin_8 Thioredoxin_6 Redoxin TraF Thioredoxin_3 Thioredoxin_9 HyaE DUF953 Thioredoxin_4 ERp29_N
Motif
Other DBs
NCBI-GeneID: 100177333
NCBI-ProteinID: XP_002129523
Ensembl: ENSCING00000007008
UniProt: A0A1W2WI87
Position
7
AA seq 512 aa AA seqDB search
MNVVKRFTLAFASILLVLSLQEVECKKKDEFSKFVQEVDNVKSFKKLIRTKTNVLVLFAE
SDSAAQKRFSVFGEAGKISKGTATLAWVDCADKEGKKLCKKQKAKPSPVEIQHYKDGEYS
STYDRKFTVKSILAFLKDPKSDGPWEEEDGAEDVVHIESEKQLNKMIKKNKPLLVMFYAP
WCGYCKRFKPVFAEAATEVKGQVVLAGLDAEGNKDSASIRQTYNITGFPKTIYFDKGKQL
FDYSGGHTKQELIDWLEEPSEPKPKEPEPSWADDITDVVHLTDETFDPFLEENKKVMVFF
YAPWCGHCKNLKPEWNKAATILKDEEAPEKLTAVDATQYSQLGNRYKVTGYPTVIYFENG
EHKYDASSAFKRTAEGIVEYIKDPKPPPPPEKAWTEVESDVVHLDDSSFKSTVKKKKHSL
VMFYAPWCGHCKKAKPEYQGAAAQFVDDKKVVFGAVDCTQNQKTCEIYDVKGYPTIYYLS
YGKNEEKYQLGREESDFVKFMSGKTGVTKTEL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtagtgaaaagatttacgctggcatttgcatcaattttattggtgctgtcgctt
caagaggttgaatgtaagaaaaaagatgaattttctaagttcgtgcaagaagtggacaac
gtaaagtcttttaaaaagttgattcggactaaaactaatgttcttgtcctatttgcagaa
tcagacagtgctgcccagaagcgattctcagtgtttggggaagctggtaaaatatcaaaa
ggcacggcaacacttgcatgggtggattgtgctgataaagaaggaaagaagttatgcaag
aagcaaaaagcaaagccttcacccgtggaaatccaacattataaagatggagagtacagt
tcaacttatgacaggaagtttactgttaagtcaatcctggctttcttgaaagatccgaag
tccgatggtccatgggaggaagaagatggagcagaggatgttgttcatattgagtcagag
aaacaacttaataagatgatcaagaagaacaaaccgctgcttgtcatgttctatgctcca
tggtgtggatattgcaagagatttaaacccgtgttcgccgaagctgctacagaagtaaaa
ggacaagttgtgttggcaggtttagatgctgagggcaacaaagattctgcctcaatcagg
caaacttacaatattactggattcccaaagacaatttatttcgacaaaggaaaacaactg
tttgattattctggtggccacactaagcaagagttaatagactggttagaggaaccttca
gaaccaaagccaaaggaacctgagccatcatgggctgatgatataactgatgttgtacat
ttgaccgatgaaacttttgatcctttcctcgaggaaaataagaaggttatggttttcttc
tatgcgccatggtgtggtcactgtaagaatttgaagcctgaatggaacaaagcggccacc
atactgaaggatgaggaagcacctgagaagcttactgctgtggatgctacacaatatagt
cagcttggtaatagatacaaggtcactggttacccaactgtaatctactttgagaatggt
gagcacaaatatgatgcttcatccgcattcaaacgaactgcggaaggaattgtggaatat
attaaagaccccaaaccacccccgccccctgagaaagcttggaccgaagttgagagcgat
gtcgtccatcttgatgattcatcattcaaatctacagtgaaaaagaagaaacattccttg
gtcatgttctacgcaccatggtgtggacattgtaagaaagcgaaaccagaataccaggga
gctgctgcacaattcgtggatgacaagaaggttgtgttcggcgctgtggattgcacacag
aaccaaaaaacttgtgaaatttacgacgtcaaaggttaccctaccatctattacttatca
tatggaaagaatgaggagaagtaccagctgggcagagaggaatcggatttcgtcaaattc
atgtcgggaaagacgggagttacgaagacagagctgtag

DBGET integrated database retrieval system