KEGG   Ciona intestinalis (sea squirt): 100177333Help
Entry
100177333         CDS       T01056                                 

Definition
protein disulfide-isomerase A5-like
Orthology
K09583  
protein disulfide isomerase family A, member 5 [EC:5.3.4.1]
Organism
cin  Ciona intestinalis (sea squirt)
Brite
Enzymes [BR:cin01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100177333
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
7
AA seq 512 aa AA seqDB search
MNVVKRFTLAFASILLVLSLQEVECKKKDEFSKFVQEVDNVKSFKKLIRTKTNVLVLFAE
SDSAAQKRFSVFGEAGKISKGTATLAWVDCADKEGKKLCKKQKAKPSPVEIQHYKDGEYS
STYDRKFTVKSILAFLKDPKSDGPWEEEDGAEDVVHIESEKQLNKMIKKNKPLLVMFYAP
WCGYCKRFKPVFAEAATEVKGQVVLAGLDAEGNKDSASIRQTYNITGFPKTIYFDKGKQL
FDYSGGHTKQELIDWLEEPSEPKPKEPEPSWADDITDVVHLTDETFDPFLEENKKVMVFF
YAPWCGHCKNLKPEWNKAATILKDEEAPEKLTAVDATQYSQLGNRYKVTGYPTVIYFENG
EHKYDASSAFKRTAEGIVEYIKDPKPPPPPEKAWTEVESDVVHLDDSSFKSTVKKKKHSL
VMFYAPWCGHCKKAKPEYQGAAAQFVDDKKVVFGAVDCTQNQKTCEIYDVKGYPTIYYLS
YGKNEEKYQLGREESDFVKFMSGKTGVTKTEL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtagtgaaaagatttacgctggcatttgcatcaattttattggtgctgtcgctt
caagaggttgaatgtaagaaaaaagatgaattttctaagttcgtgcaagaagtggacaac
gtaaagtcttttaaaaagttgattcggactaaaactaatgttcttgtcctatttgcagaa
tcagacagtgctgcccagaagcgattctcagtgtttggggaagctggtaaaatatcaaaa
ggcacggcaacacttgcatgggtggattgtgctgataaagaaggaaagaagttatgcaag
aagcaaaaagcaaagccttcacccgtggaaatccaacattataaagatggagagtacagt
tcaacttatgacaggaagtttactgttaagtcaatcctggctttcttgaaagatccgaag
tccgatggtccatgggaggaagaagatggagcagaggatgttgttcatattgagtcagag
aaacaacttaataagatgatcaagaagaacaaaccgctgcttgtcatgttctatgctcca
tggtgtggatattgcaagagatttaaacccgtgttcgccgaagctgctacagaagtaaaa
ggacaagttgtgttggcaggtttagatgctgagggcaacaaagattctgcctcaatcagg
caaacttacaatattactggattcccaaagacaatttatttcgacaaaggaaaacaactg
tttgattattctggtggccacactaagcaagagttaatagactggttagaggaaccttca
gaaccaaagccaaaggaacctgagccatcatgggctgatgatataactgatgttgtacat
ttgaccgatgaaacttttgatcctttcctcgaggaaaataagaaggttatggttttcttc
tatgcgccatggtgtggtcactgtaagaatttgaagcctgaatggaacaaagcggccacc
atactgaaggatgaggaagcacctgagaagcttactgctgtggatgctacacaatatagt
cagcttggtaatagatacaaggtcactggttacccaactgtaatctactttgagaatggt
gagcacaaatatgatgcttcatccgcattcaaacgaactgcggaaggaattgtggaatat
attaaagaccccaaaccacccccgccccctgagaaagcttggaccgaagttgagagcgat
gtcgtccatcttgatgattcatcattcaaatctacagtgaaaaagaagaaacattccttg
gtcatgttctacgcaccatggtgtggacattgtaagaaagcgaaaccagaataccaggga
gctgctgcacaattcgtggatgacaagaaggttgtgttcggcgctgtggattgcacacag
aaccaaaaaacttgtgaaatttacgacgtcaaaggttaccctaccatctattacttatca
tatggaaagaatgaggagaagtaccagctgggcagagaggaatcggatttcgtcaaattc
atgtcgggaaagacgggagttacgaagacagagctgtag

DBGET integrated database retrieval system