KEGG   Ciona intestinalis (sea squirt): 100177407Help
Entry
100177407         CDS       T01056                                 

Definition
catechol O-methyltransferase-like
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    100177407
Enzymes [BR:cin01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     100177407
Exosome [BR:cin04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100177407
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 218 aa AA seqDB search
MAKGTDLTFPYHIVDHVVKTAKRGDVSSVIDVIDQYCYSVEKAMNVGDVKGAILDKCFLE
ASPQNVLELGCYCGYSSLRMSRLLKEDAKIFTIEANPDYAKFAQQIITFAGMEKRIQILQ
GLSDEVLPTIAEKCGVQTFDFVFIDHAKELYKRDLIMLENLGLIRHGTTIVADNVIYPGC
PDYLKYVRNNPKYKSANYLSKLEYTDREDAIEKSIYLP
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaaggcactgatttaacttttccatatcacatcgttgatcacgtggtcaaaacg
gccaagcgtggtgacgtgagcagtgtcattgacgtcatagaccagtattgttacagcgta
gaaaaggcaatgaacgtcggcgacgtaaaaggagcgattttggataaatgttttttggag
gcgtcgccgcagaatgtgttggagttgggatgctattgtgggtatagctctcttagaatg
agccgactgctaaaggaagacgcaaagatattcactatagaagcaaatccagattacgcc
aagtttgcccaacaaattataacctttgctggcatggagaaaaggattcaaattttgcag
ggtttgagcgacgaagttctaccaactattgctgaaaaatgtggagttcagacttttgac
tttgtttttattgaccacgctaaagagctttataagcgggatcttatcatgctggagaat
cttgggttaataagacatgggacgactatcgtggctgataacgttatataccccggttgc
ccagattacttgaaatatgtgagaaataacccgaaatataaaagcgcaaactatctttcg
aaattggagtatacggatcgcgaggacgccatagaaaagtcgatatacttaccatga

DBGET integrated database retrieval system