KEGG   Ciona intestinalis (sea squirt): 100177446Help
Entry
100177446         CDS       T01056                                 

Definition
zinc finger protein-like
Orthology
K04725  
E3 ubiquitin-protein ligase XIAP
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Ubiquitin mediated proteolysis
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:cin04120]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
14
AA seq 510 aa AA seqDB search
MELANNLFSDIETDGMKVNTTSEPSDKRCVYITPGQKEREDYRITTFNKFPSNKPVDKMK
LSSNGFLYTGFKDRVKCFRCGQCVEGLNGTENMGLPGWHKPDCEFANGTDTTNVPLLRHK
IQQNLPSLQNASFVQSIPNQDQTTLSAGELLKFGNIDQTTNQVVTPRNLPVQQSSNQFGQ
MYQTATIHKPHLQVPFSVLQSTRATEPAPRCAENSQFPCSNPRNPHMKSERVRLQTFMHN
LGKWSSHGIVTTPEQMADAGLFYLGDRDRTKCWYCNGGLQNWEPNDDPWYEHAKWFPECE
FVLQQKGELYVHRIARQFPNLNRPRISNPYQLFGRSNNDVPPPQPQPQSPGPVIIDPQEE
QRKLKSKIDEEMESSAVVDGAKQMGFEEKEIKRAITKNMKENGKSFSTLLSLVDAILADN
GDDNTSSEEQSEAPTAPETTLTFNTDQQSTASELQRLEMARFCKICRQKEAVVVLLPCGH
LSCCDTCGKEITKCPACKLAVTDKVHSFIA
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggaattggcaaacaatttattctcggatatcgaaactgacggaatgaaagtgaacaca
acatctgaaccatcagacaaacgatgtgtttatattacaccaggccaaaaggaaagagaa
gattaccgaattacgactttcaataaattcccttctaacaaacctgttgacaaaatgaaa
ttgtcttcaaatggatttctgtacacagggtttaaagacagagtaaagtgtttcaggtgt
gggcaatgtgttgaaggcttaaatggcacagaaaacatgggtttacctggatggcataaa
ccagattgtgaattcgcaaatgggacagacaccactaatgtaccactacttcgccataaa
attcaacaaaatctgcctagtttacaaaacgccagctttgtccaatccattccaaatcag
gaccaaacaacattatcagccggagaacttttaaaattcggaaatattgaccaaacgaca
aaccaagtagttaccccaagaaacctaccagtgcaacaatcatcaaatcaatttgggcaa
atgtaccagacagctactatacacaaaccacatctccaagtgcctttctctgttctacaa
tctaccagagcaacagaaccagctccaaggtgcgcagaaaattctcaattcccctgcagt
aacccaagaaacccacacatgaagagtgaaagagtaagactgcagacttttatgcataat
ttgggaaaatggtcttctcatggaatagttaccacaccagaacaaatggcagatgctggt
ttattttacttgggtgacagagatcgcaccaaatgttggtattgtaacggaggtttacag
aactgggaacctaatgatgacccctggtatgaacatgcaaagtggtttcctgagtgtgag
ttcgttttacagcaaaaaggtgaactttatgtgcaccgaatagcaaggcagtttcctaac
ctcaacagaccacgaatttctaacccttaccaattgtttggtagaagcaacaatgacgta
ccaccacctcaacctcaaccacaaagtcctggccctgtgattattgacccacaagaagaa
caaaggaaattgaaatccaaaattgatgaagaaatggaatcatctgctgtagtggatggc
gcaaaacaaatgggttttgaagagaaagaaattaagcgcgcaattacaaaaaatatgaaa
gaaaatggaaaatctttttccacattgctcagcctagtagatgctatactggcagataac
ggtgatgataacacctcatcagaagagcaaagtgaggcccccacagctccagaaactact
ttaacattcaatactgatcagcagtcaactgccagcgagttacagcgtttagaaatggct
cgattttgtaaaatttgccggcaaaaagaagcagtagtcgttttgttgccgtgtgggcat
ttatcttgctgcgacacatgcggaaaagaaattacaaaatgtccggcatgcaaattagct
gtaacagataaagtgcattcatttattgcttga

DBGET integrated database retrieval system