KEGG   Ciona intestinalis (sea squirt): 100177446Help
Entry
100177446         CDS       T01056                                 

Definition
(RefSeq) baculoviral IAP repeat-containing protein 2
  KO
K04725  
E3 ubiquitin-protein ligase XIAP [EC:2.3.2.27]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:cin00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100177446
Enzymes [BR:cin01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100177446
Ubiquitin system [BR:cin04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    100177446
Mitochondrial biogenesis [BR:cin03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    100177446
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
14
AA seq 510 aa AA seqDB search
MELANNLFSDIETDGMKVNTTSEPSDKRCVYITPGQKEREDYRITTFNKFPSNKPVDKMK
LSSNGFLYTGFKDRVKCFRCGQCVEGLNGTENMGLPGWHKPDCEFANGTDTTNVPLLRHK
IQQNLPSLQNASFVQSIPNQDQTTLSAGELLKFGNIDQTTNQVVTPRNLPVQQSSNQFGQ
MYQTATIHKPHLQVPFSVLQSTRATEPAPRCAENSQFPCSNPRNPHMKSERVRLQTFMHN
LGKWSSHGIVTTPEQMADAGLFYLGDRDRTKCWYCNGGLQNWEPNDDPWYEHAKWFPECE
FVLQQKGELYVHRIARQFPNLNRPRISNPYQLFGRSNNDVPPPQPQPQSPGPVIIDPQEE
QRKLKSKIDEEMESSAVVDGAKQMGFEEKEIKRAITKNMKENGKSFSTLLSLVDAILADN
GDDNTSSEEQSEAPTAPETTLTFNTDQQSTASELQRLEMARFCKICRQKEAVVVLLPCGH
LSCCDTCGKEITKCPACKLAVTDKVHSFIA
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggaattggcaaacaatttattctcggatatcgaaactgacggaatgaaagtgaacaca
acatctgaaccatcagacaaacgatgtgtttatattacaccaggccaaaaggaaagagaa
gattaccgaattacgactttcaataaattcccttctaacaaacctgttgacaaaatgaaa
ttgtcttcaaatggatttctgtacacagggtttaaagacagagtaaagtgtttcaggtgt
gggcaatgtgttgaaggcttaaatggcacagaaaacatgggtttacctggatggcataaa
ccagattgtgaattcgcaaatgggacagacaccactaatgtaccactacttcgccataaa
attcaacaaaatctgcctagtttacaaaacgccagctttgtccaatccattccaaatcag
gaccaaacaacattatcagccggagaacttttaaaattcggaaatattgaccaaacgaca
aaccaagtagttaccccaagaaacctaccagtgcaacaatcatcaaatcaatttgggcaa
atgtaccagacagctactatacacaaaccacatctccaagtgcctttctctgttctacaa
tctaccagagcaacagaaccagctccaaggtgcgcagaaaattctcaattcccctgcagt
aacccaagaaacccacacatgaagagtgaaagagtaagactgcagacttttatgcataat
ttgggaaaatggtcttctcatggaatagttaccacaccagaacaaatggcagatgctggt
ttattttacttgggtgacagagatcgcaccaaatgttggtattgtaacggaggtttacag
aactgggaacctaatgatgacccctggtatgaacatgcaaagtggtttcctgagtgtgag
ttcgttttacagcaaaaaggtgaactttatgtgcaccgaatagcaaggcagtttcctaac
ctcaacagaccacgaatttctaacccttaccaattgtttggtagaagcaacaatgacgta
ccaccacctcaacctcaaccacaaagtcctggccctgtgattattgacccacaagaagaa
caaaggaaattgaaatccaaaattgatgaagaaatggaatcatctgctgtagtggatggc
gcaaaacaaatgggttttgaagagaaagaaattaagcgcgcaattacaaaaaatatgaaa
gaaaatggaaaatctttttccacattgctcagcctagtagatgctatactggcagataac
ggtgatgataacacctcatcagaagagcaaagtgaggcccccacagctccagaaactact
ttaacattcaatactgatcagcagtcaactgccagcgagttacagcgtttagaaatggct
cgattttgtaaaatttgccggcaaaaagaagcagtagtcgttttgttgccgtgtgggcat
ttatcttgctgcgacacatgcggaaaagaaattacaaaatgtccggcatgcaaattagct
gtaacagataaagtgcattcatttattgcttga

DBGET integrated database retrieval system