KEGG   Ciona intestinalis (sea squirt): 100177462Help
Entry
100177462         CDS       T01056                                 

Definition
(RefSeq) uncharacterized LOC100177462
  KO
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.4.19.12]
Organism
cin  Ciona intestinalis (sea squirt)
Brite
Enzymes [BR:cin01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100177462
Peptidases [BR:cin01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100177462
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
10
AA seq 1044 aa AA seqDB search
MKELEMEVVMTCQPPPNSEDKENAKDNEETEILTMDVQPFVPQDTPATSTNHGVCGLYNL
GNTCYMNSTLQCLLHNSQLMEQMSLKSSSSKNESGISGHFLNLFKKYWSGEYSVIVPSEF
KDQLSKIHTQFAGNGQHDGQELLALFLESLHQEIKGSTPIAPTLSVVSDETVKRKRTKST
ESLDDGRPNNKRMDIVATNGHHTNLLTINSFFGKEKKTANVNVLSSEVECDEEATTDHSN
KFPQTVCSRLNNGQLMGDTEITSPVPQQKKPMDQTNSQDITTGVELKKLQLTKYKQTNLL
AELKRIDSETTSTPNFDKIFNDPVTQFKQNCTNSLLPSSTFQFNSNTPYSALETPIFYSE
IASPVFTSHFIPHENILNKKRKNQIHIPSLQSFDQDTLAVTALSPPLDLAGQPFAPQKLY
SLRRSNSIPNLCQNFRKSKNVDFYEPSFCVNGEGVENGFSNNERNFVCETDTSCGLQSIS
GDRGLLLTKFTNILVDESAEPATGSSTIGGNCSDTMSNLRDDISSTSPSGDHNSNAIADK
IWNSYIQANQSVVVDTFQGQLESTVVCSKCGFKSVTHEPFMYLSLPIPHALNRCINVHVS
PLDHTSQHFSVYAPRHGKISDLQEQLIKSNKPELHTTDLTNFLFCEVKGYNIMEILEGNM
PLKNLNDKTRKLELMEFLKLKSENDEKAELSPTAANTSWNSCCICLDEFSDSELLQHQRE
SCPILICPSCLENSVEHYGIENFSCPVCHTHCYPVTDFVPLPSCNQNRDVLVTISFTFLD
EDNVVQVISEAKLLNTSTTVSWDVLYEAITKLTPPHLHEDFTLVLSTRDGTYCSRCQYPT
TCRGCPLPQGEKVTLQPGDNISCRFTGSPNHVNKKQPPVAKINSTEDVLTLEKCLSAFTK
NEILDVDNPWYCPACCGHQVAEKRLRICRWPDTLIVYIKRFLYHSKNAVKVDDEVLFPME
SFSPGQLSGTHPHNFKSYDLTACMSHFGGVYSGHYVAHCKHPVTGKWHLFNDENISEQTL
SSKDSAGAYVLFYQHKPSHNTELV
NT seq 3135 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagcttgaaatggaagttgtaatgacttgtcaaccaccaccgaattctgaagat
aaagaaaatgcaaaagacaatgaagaaacagaaattttaacaatggacgtccagcctttt
gtgccgcaagatactccagctacttcaaccaaccatggtgtatgtggtttatacaatcta
ggaaatacttgttacatgaacagcacattacaatgcctattacacaattctcaactaatg
gaacaaatgtcattgaaatcttcaagctctaaaaatgaaagtggtataagtggtcatttt
cttaacctattcaagaagtattggagtggcgaatattctgtgattgttccaagtgaattt
aaagaccaactctcaaaaattcatactcagtttgccggcaatgggcagcatgacgggcag
gaacttcttgctttatttttggagtctttacatcaagaaataaaaggaagtactcccatt
gctccaacattatctgtggtttcagatgaaactgtgaaacgaaaacgaactaaaagcacc
gaaagtcttgatgatgggcgaccaaataataaacgaatggatatcgttgccaccaacggc
caccataccaacctattaaccatcaattctttctttggtaaagagaagaagacggcaaat
gtgaatgttctaagcagtgaagtagaatgtgatgaagaagccaccacggatcatagcaac
aagtttccacaaactgtatgctccagacttaacaatggtcaacttatgggagatactgaa
atcacaagcccagtccctcagcagaagaaaccaatggaccaaaccaactcccaagacatc
actactggcgttgaattaaagaagctgcaactcactaagtacaagcaaacaaacttgtta
gcggaactcaagcgaatagatagtgaaactacttccactcccaactttgacaagattttc
aatgatccagtcacgcagttcaagcagaactgcacaaactctcttctcccatcttctaca
tttcaattcaattcaaacacaccgtactctgcactggaaacccctattttctactctgaa
attgcttcaccagtatttacaagccattttatacctcatgaaaatattctaaacaaaaaa
cggaaaaatcaaattcacataccatcactacagtcatttgaccaagacacattagcagta
acagccttatcacccccactggatttagcagggcagccctttgcaccacaaaagctatac
tctctaaggcgttctaacagcataccaaatttgtgccaaaattttcgaaaatcgaaaaat
gttgatttttatgagcctagcttctgtgttaacggtgagggtgtagaaaatggattttcg
aataacgaacgcaattttgtttgtgaaactgacaccagttgtgggctacagtcaatatct
ggagacagaggtttactgctcacaaagtttaccaatatacttgtggatgagagtgcagag
cctgcaactggtagttcaactatcgggggcaactgttctgatacaatgtctaatttaaga
gatgatatatcaagtacaagtcccagcggcgatcataattcaaacgctattgctgataaa
atatggaacagttatatacaagctaaccaatctgtggtagtagatactttccaaggccaa
ctagaaagcacagttgtctgttcgaaatgtggattcaagtctgtaacgcacgaaccattc
atgtatttgtcgttaccaatacctcatgctctcaaccggtgtatcaacgtgcatgtctcc
ccacttgaccacacctcacagcacttctcagtgtacgcaccacgccatgggaaaatatct
gacttacaggaacaactgattaaatcaaataaacctgaactgcatacaacggacttaacc
aactttttattctgtgaagtgaagggttataacattatggaaatactagagggaaacatg
ccgctcaaaaatttgaacgacaaaaccagaaaattggagctaatggagtttcttaaatta
aaatcagaaaatgatgaaaaagctgaattatcacccacagcagcaaacacttcatggaat
tcttgttgtatttgtttggacgagttttctgattcagaacttcttcaacaccagcgtgaa
tcttgtcctattcttatttgcccctcatgtttggaaaattcagttgaacattatggaata
gagaatttttcttgcccagtttgccatacacattgttatccagttactgactttgtacct
ctgccatcatgcaaccagaacagagacgtactggttactatcagctttacattccttgat
gaagacaatgttgttcaagtaattagtgaagccaagctactgaacacttcaactactgtg
tcatgggatgtattatatgaagctattacaaagcttaccccaccacatctgcatgaagac
tttacgttggtgctttccacacgagatggaacttattgctccagatgtcagtaccccacc
acttgtaggggatgccccttaccccagggtgaaaaggtcactttacagccgggtgacaac
atttcttgcaggtttactggttcaccaaatcatgtcaataaaaaacaaccaccagttgct
aaaatcaattctactgaagatgtgcttacacttgaaaagtgcctgagtgcgtttactaag
aatgagatattagacgtcgacaatccctggtattgccctgcttgctgtggacatcaagtg
gccgaaaaacgacttcggatttgtcgttggccagatacgcttatagtttatattaaacga
tttctctatcatagtaaaaatgctgtgaaagttgacgatgaggttttatttccaatggaa
tccttcagtcctggtcaactgagtggaactcacccacataacttcaaatcatacgatctt
acagcttgtatgtcccattttggaggtgtatactctggtcactatgtggcccactgcaaa
cacccagtgactgggaaatggcatttatttaacgatgaaaatatatcagagcaaaccctg
tcttccaaagatagcgctggtgcctatgttctgttctaccaacataagccatcacataac
actgagctagtatga

DBGET integrated database retrieval system