KEGG   Ciona intestinalis (sea squirt): 100177462Help
Entry
100177462         CDS       T01056                                 

Definition
uncharacterized LOC100177462
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
cin  Ciona intestinalis (sea squirt)
Brite
Enzymes [BR:cin01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100177462
Peptidases [BR:cin01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100177462
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
10
AA seq 852 aa AA seqDB search
MDIVATNGHHTNLLTINSFFGKEKKTANVNVLSSEVECDEEATTDHSNKFPQTVCSRLNN
GQLMGDTEITSPVPQQKKPMDQTNSQDITTGVELKKLQLTKYKQTNLLAELKRIDSETTS
TPNFDKIFNDPVTQFKQNCTNSLLPSSTFQFNSNTPYSALETPIFYSEIASPVFTSHFIP
HENILNKKRKNQIHIPSLQSFDQDTLAVTALSPPLDLAGQPFAPQKLYSLRRSNSIPNLC
QNFRKSKNVDFYEPSFCVNGEGVENGFSNNERNFVCETDTSCGLQSISGDRGLLLTKFTN
ILVDESAEPATGSSTIGGNCSDTMSNLRDDISSTSPSGDHNSNAIADKIWNSYIQANQSV
VVDTFQGQLESTVVCSKCGFKSVTHEPFMYLSLPIPHALNRCINVHVSPLDHTSQHFSVY
APRHGKISDLQEQLIKSNKPELHTTDLTNFLFCEVKGYNIMEILEGNMPLKNLNDKTRKL
ELMEFLKLKSENDEKAELSPTAANTSWNSCCICLDEFSDSELLQHQRESCPILICPSCLE
NSVEHYGIENFSCPVCHTHCYPVTDFVPLPSCNQNRDVLVTISFTFLDEDNVVQVISEAK
LLNTSTTVSWDVLYEAITKLTPPHLHEDFTLVLSTRDGTYCSRCQYPTTCRGCPLPQGEK
VTLQPGDNISCRFTGSPNHVNKKQPPVAKINSTEDVLTLEKCLSAFTKNEILDVDNPWYC
PACCGHQVAEKRLRICRWPDTLIVYIKRFLYHSKNAVKVDDEVLFPMESFSPGQLSGTHP
HNFKSYDLTACMSHFGGVYSGHYVAHCKHPVTGKWHLFNDENISEQTLSSKDSAGAYVLF
YQHKPSHNTELV
NT seq 2559 nt NT seq  +upstreamnt  +downstreamnt
atggatatcgttgccaccaacggccaccataccaacctattaaccatcaattctttcttt
ggtaaagagaagaagacggcaaatgtgaatgttctaagcagtgaagtagaatgtgatgaa
gaagccaccacggatcatagcaacaagtttccacaaactgtatgctccagacttaacaat
ggtcaacttatgggagatactgaaatcacaagcccagtccctcagcagaagaaaccaatg
gaccaaaccaactcccaagacatcactactggcgttgaattaaagaagctgcaactcact
aagtacaagcaaacaaacttgttagcggaactcaagcgaatagatagtgaaactacttcc
actcccaactttgacaagattttcaatgatccagtcacgcagttcaagcagaactgcaca
aactctcttctcccatcttctacatttcaattcaattcaaacacaccgtactctgcactg
gaaacccctattttctactctgaaattgcttcaccagtatttacaagccattttatacct
catgaaaatattctaaacaaaaaacggaaaaatcaaattcacataccatcactacagtca
tttgaccaagacacattagcagtaacagccttatcacccccactggatttagcagggcag
ccctttgcaccacaaaagctatactctctaaggcgttctaacagcataccaaatttgtgc
caaaattttcgaaaatcgaaaaatgttgatttttatgagcctagcttctgtgttaacggt
gagggtgtagaaaatggattttcgaataacgaacgcaattttgtttgtgaaactgacacc
agttgtgggctacagtcaatatctggagacagaggtttactgctcacaaagtttaccaat
atacttgtggatgagagtgcagagcctgcaactggtagttcaactatcgggggcaactgt
tctgatacaatgtctaatttaagagatgatatatcaagtacaagtcccagcggcgatcat
aattcaaacgctattgctgataaaatatggaacagttatatacaagctaaccaatctgtg
gtagtagatactttccaaggccaactagaaagcacagttgtctgttcgaaatgtggattc
aagtctgtaacgcacgaaccattcatgtatttgtcgttaccaatacctcatgctctcaac
cggtgtatcaacgtgcatgtctccccacttgaccacacctcacagcacttctcagtgtac
gcaccacgccatgggaaaatatctgacttacaggaacaactgattaaatcaaataaacct
gaactgcatacaacggacttaaccaactttttattctgtgaagtgaagggttataacatt
atggaaatactagagggaaacatgccgctcaaaaatttgaacgacaaaaccagaaaattg
gagctaatggagtttcttaaattaaaatcagaaaatgatgaaaaagctgaattatcaccc
acagcagcaaacacttcatggaattcttgttgtatttgtttggacgagttttctgattca
gaacttcttcaacaccagcgtgaatcttgtcctattcttatttgcccctcatgtttggaa
aattcagttgaacattatggaatagagaatttttcttgcccagtttgccatacacattgt
tatccagttactgactttgtacctctgccatcatgcaaccagaacagagacgtactggtt
actatcagctttacattccttgatgaagacaatgttgttcaagtaattagtgaagccaag
ctactgaacacttcaactactgtgtcatgggatgtattatatgaagctattacaaagctt
accccaccacatctgcatgaagactttacgttggtgctttccacacgagatggaacttat
tgctccagatgtcagtaccccaccacttgtaggggatgccccttaccccagggtgaaaag
gtcactttacagccgggtgacaacatttcttgcaggtttactggttcaccaaatcatgtc
aataaaaaacaaccaccagttgctaaaatcaattctactgaagatgtgcttacacttgaa
aagtgcctgagtgcgtttactaagaatgagatattagacgtcgacaatccctggtattgc
cctgcttgctgtggacatcaagtggccgaaaaacgacttcggatttgtcgttggccagat
acgcttatagtttatattaaacgatttctctatcatagtaaaaatgctgtgaaagttgac
gatgaggttttatttccaatggaatccttcagtcctggtcaactgagtggaactcaccca
cataacttcaaatcatacgatcttacagcttgtatgtcccattttggaggtgtatactct
ggtcactatgtggcccactgcaaacacccagtgactgggaaatggcatttatttaacgat
gaaaatatatcagagcaaaccctgtcttccaaagatagcgctggtgcctatgttctgttc
taccaacataagccatcacataacactgagctagtatga

DBGET integrated database retrieval system