KEGG   Ciona intestinalis (sea squirt): 100177594Help
Entry
100177594         CDS       T01056                                 

Definition
protoporphyrinogen oxidase-like
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    100177594
Enzymes [BR:cin01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     100177594
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
7
AA seq 519 aa AA seqDB search
MKFVVCGGGISGLASAYYLNKALARTTSKPYKIFLIEKSTNVGGWMKTNVRNGDRKVYQG
AINERGPRSVRTAGLVGNNTLQLISDIGMESNVIPVRSDDIAAKQRLLYVNKKLHILPNS
LLSACKKQQPFSNSLARSFVGGLLKKVPPSYETMSEICSERFGREVADYLVSAFVRGVFA
ADSKQLSMKAAFPPLWGRLGPREAQMPRRPTLKNPDLFNKSLKSNPFIKRAKREKWTQWG
VDNGFSYLTDNLEQQLAQVDNIEIIKYTNIDEIMMQNNGKMMMSTTTIRRGEYTTEQIEN
IDHTISALPSYALSRILKNSNKQSNIQMSSNNEFVSSTLGIMLSHIKWVDVGVVNVEFSG
KPNEILPHVGFGHLVPSSEPSSVLGIVYDSCAFPQHDRVNMPTTRMTCMMGGSWFRELFG
EPNLVSNQTLESAALGSISQQLGIHEDPMNVDTTLCKKCIPTYRVGHTDLVENIEDFISE
HDVPLSLVGASYWGVSINDCIFNSRVAVNNILKKYKLSP
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgttgtgtgtggtggtggtataagtggacttgcctctgcttattatttaaac
aaagcattggctcgtaccacttctaaaccatacaagatatttcttattgaaaagtcaaca
aatgttggagggtggatgaaaacaaatgtaaggaatggtgatagaaaggtataccaaggt
gcaataaatgagcgtggtccacgcagtgtaagaactgcagggttggttggcaacaatact
ctgcaattaatttcagatattggaatggaatccaatgttattcctgtgagatctgatgac
attgcggcgaaacaaagactcctctacgttaataaaaagttacatatcttaccaaacagt
ctgttatctgcatgtaagaagcaacaaccattttctaattcattggcaagatcttttgtt
gggggtttgttgaaaaaggttccaccaagttatgaaacaatgagtgaaatttgcagtgaa
aggtttggacgcgaagttgccgattatttggtcagtgcatttgtgagaggggtgtttgcc
gctgattcaaaacaattaagtatgaaagctgcatttccaccattgtggggtagactggga
ccaagagaggcacaaatgcccagaaggccgactctgaagaatccagatctatttaataaa
agcttaaaatcaaatccttttatcaaacgagctaaacgtgaaaaatggacgcagtgggga
gttgataacggcttctcgtatttgaccgataatcttgagcaacaacttgcccaagtagat
aacatagaaataataaaatatacaaatattgatgaaataatgatgcagaacaacgggaaa
atgatgatgtccactacgacaattagaagaggtgaatatacaaccgaacaaattgagaat
attgatcacacgatatctgcgctaccttcttatgctctcagtcgaatactgaagaattcc
aacaaacaatctaatattcaaatgtcgagtaataacgagtttgtttcttcaacacttggt
ataatgcttagtcatattaaatgggtagatgtcggggtagtaaacgtggaattctctgga
aaaccaaatgaaattcttccccatgttggtttcggacatctagtgccatctagtgagcct
tccagtgttctcgggattgtttatgattcttgtgcattcccacaacatgatagggtaaac
atgccaaccactagaatgacttgtatgatgggaggctcatggttccgggaattatttggt
gaaccgaatcttgtttcaaatcaaacgttagaaagtgcagcattgggaagtatatctcaa
cagcttggtatacatgaggacccaatgaacgttgacacaacattatgcaaaaaatgcatt
ccaacatacagagttggccacacggatcttgttgaaaatattgaagattttatatcggaa
cacgatgtacctctgtcattggttggtgcatcgtattggggggtcagcataaacgattgt
atttttaacagccgagtagctgtcaacaatatccttaaaaaatacaagctttctccgtaa

DBGET integrated database retrieval system