KEGG   Ciona intestinalis (sea squirt): 100177767Help
Entry
100177767         CDS       T01056                                 

Definition
(RefSeq) STAM-binding protein-like A
  KO
K11866  
STAM-binding protein [EC:3.4.19.12]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:cin00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100177767
Enzymes [BR:cin01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100177767
Peptidases [BR:cin01002]
 Metallo Peptidases
  Family M67
   100177767
Membrane trafficking [BR:cin04131]
 Endosome - Lysosome transport
  Others
   Others
    100177767
Ubiquitin system [BR:cin04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   JAMM
    100177767
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
6
AA seq 340 aa AA seqDB search
MKKNIKDIKKTRKNWNFRQKQEEEKRKKEEEEERKRKEEIKKKAEEEQMNAFIQEQRRKE
LELERLAIVAEFADKVKVDDNGPLVPADFAPPPPEPFNDIATNTTTYKPQPTVPTPPALP
SYDRSLKPVDLTNNYQPEVKQPPATTSTSSFAASLTQSKNKYGLRTILSPADLPTKFMQL
AHSNTSRNIETCGVLFGKLANEVFVITHVLIPHQKGAPDSCDTTREEDMWDFQDQYDGIC
LGWIHTHPSQTAFLSSVDMHTHYPYQCLMPESVAIVCSGKFNEVGYFMLDPGRGMNEIGK
CRKPGFHPHPTTPPLFESCDHVKPSPTDAVHIVDWRLKPM
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagaatataaaagatataaagaaaaccagaaaaaactggaacttcaggcaaaaa
caagaagaagagaaaaggaaaaaagaggaagaggaggagagaaagagaaaagaagaaata
aagaaaaaggcagaggaggagcagatgaatgcttttattcaagagcaaagaagaaaggaa
cttgaactagagcgtcttgccatcgttgcagaatttgcagataaagtgaaagtagacgac
aacggtccattagtcccagcagattttgcccccccacccccagaaccctttaatgatatt
gccacgaacacaacaacatataaacctcaacccactgtaccaacaccaccagccctacca
agttacgaccgttcattaaaaccagttgatttaaccaacaattaccaacctgaagtaaaa
caaccaccagcgacgacgtctacttcttcatttgctgcctcactgacgcagtcaaaaaat
aaatatggattacgaaccatactctcgcctgctgatctaccaacaaagtttatgcagctt
gcgcatagcaacacaagcaggaatattgagacttgtggagttctgttcggaaaactagcg
aatgaggtgttcgttatcacccatgttctcataccccaccaaaaaggtgccccagatagt
tgcgacacaacaagggaagaagacatgtgggatttccaagaccaatacgacggcatttgc
cttggttggatacatactcatccttcgcaaacagcattcttatcaagtgtagacatgcat
acacattatccataccaatgcctgatgccggaatcagttgctattgtgtgctcaggaaag
tttaatgaggttgggtactttatgttagaccctggaagagggatgaatgaaataggtaaa
tgcaggaaacctggtttccacccccatcctacaacacccccactgtttgaatcctgtgat
catgttaagccatcacccactgatgccgtccatatagtagactggagattaaaaccaatg
taa

DBGET integrated database retrieval system