KEGG   Ciona intestinalis (sea squirt): 100177811Help
Entry
100177811         CDS       T01056                                 

Definition
liver carboxylesterase 4-like
Orthology
K03927  
carboxylesterase 2 [EC:3.1.1.1 3.1.1.84 3.1.1.56]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100177811
Enzymes [BR:cin01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     100177811
    3.1.1.56  methylumbelliferyl-acetate deacetylase
     100177811
    3.1.1.84  cocaine esterase
     100177811
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 551 aa AA seqDB search
MTECPTVTTAYGKVRGKVLKSLGVSGSKEVYKFAGVPFAKPPVGALRFEPPQKPDSWDGV
KETTKSGPIPMQDARANAKLLPYLMAHVDALETGFERSEDCLYLDVYTPSTSDSSSLPVM
VWIYGGGLQNGFGNIYHAHCLCALYDVVVVVPTYRVNICGFLTLGADTKWPGNIGMLDQV
AALKWTRDNVKGFGGDPSNVTIFGESAGAFSVGLHVVSPMSKGLFHRAISHSGTAHFPVL
LSRSSKDALQSLLEFLNIKETKPEVIVEKLKQVPMQQLLEAQWKIQTEKGLFHIFYSCVD
NKFITDDPLNIWKAKGTAPVPYMVGCNNSEGDGILVAIVTDNDATEEKTLQFIQDSLQAM
ETPANKMEEAVSIVLQKYATGLDNDKEKWMKMYGALMRDLWFIVPSIMQCNAHAAAGRKT
FLYYMTQQPRHNHTNQYGAEIKNKPDHCECDHADDILYTFGLPLFSKDQFKPEVEFSEED
KTFSLHWMAYITNFAKYGDPNKGHDVPVNWPTYDEANGYFLEASNEIRARKNLKPDTFEF
WTKIIPAFIKK
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgacggagtgtcctactgtaacaaccgcatatggaaaggtacggggaaaagtactgaaa
agtcttggggtcagtggttcaaaggaagtttataaattcgcaggtgttccttttgctaaa
ccacctgttggggcattgagatttgaacctccacaaaaacccgattcttgggatggtgtg
aaagaaactacaaaaagtggtccaataccaatgcaagatgcaagggcgaatgcaaagctt
ctaccgtatttaatggcgcacgtggatgcgttggaaactgggtttgaaaggagtgaagat
tgtctttatttggatgtctatactccttcgacatcagactcttcttctttaccggtgatg
gtttggatatatggcggtgggctgcagaacgggtttgggaatatttaccacgcgcattgc
ttatgtgcattatacgatgtcgtggttgttgttccaacataccgtgtgaatatttgtggg
tttttgacgctgggtgctgatactaaatggccgggaaacatcgggatgctggatcaagta
gcggcacttaagtggacacgcgacaacgtgaaaggtttcggtggcgacccctcgaacgtc
acaatatttggagaaagtgccggggctttttccgtcggtctacatgttgtatctccaatg
tcaaagggtctctttcatcgcgccatctcgcacagtggaactgctcactttccagtgctg
ctatcacgtagttcaaaagatgcgcttcaatcgttgttggaattcttaaacataaaagaa
actaaacctgaggtaatcgttgagaagctgaagcaagttccgatgcaacaactgcttgaa
gcgcagtggaaaatacaaacagagaagggactctttcatatattttactcgtgtgtggat
aataagttcattacggatgatccgctgaacatatggaaggctaagggcaccgcaccagtt
ccttatatggtaggatgcaacaattctgaaggtgatgggatattagtcgcgattgtaact
gataacgatgcaaccgaagaaaaaacgcttcaatttattcaagacagtctgcaagctatg
gaaaccccggcaaataagatggaagaagccgtgtctatagttttacaaaaatatgccacc
ggtttggacaacgataaggaaaaatggatgaaaatgtatggcgcactcatgagggacttg
tggttcattgtgcctagtataatgcaatgtaacgcacatgctgcggcagggcgcaaaaca
ttcctttattacatgacacaacaaccacggcataaccataccaaccaatatggagcagaa
attaaaaacaagccggatcattgtgagtgtgaccatgctgatgacatcctctacacattt
gggttgcccctcttctctaaggatcagttcaaaccggaagtcgagttcagtgaggaagat
aagacgttttccctccactggatggcgtatataacaaacttcgcgaaatatggagaccca
aataaaggccacgacgttcctgtcaattggccgacatacgacgaggcgaacgggtatttt
ctcgaagcctctaacgagatcagggcgcgaaaaaacttaaaaccagacacgtttgagttt
tggaccaaaatcattcccgcttttataaagaaataa

DBGET integrated database retrieval system