KEGG   Ciona intestinalis (sea squirt): 100177816Help
Entry
100177816         CDS       T01056                                 

Definition
cyclin-H-like
Orthology
K06634  
cyclin H
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Basal transcription factors
Nucleotide excision repair
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:cin03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:cin03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 329 aa AA seqDB search
MFNSSTQLKNWTFEHEEELIKLRNNANTKYRTSYCDVNNHVTPDADTFFLTVSEHCFLVQ
HYERKLQEICWKFKPPMPLNVVGTSCMYLKRLNLRKSVMDYHPRLMHLACIWLACKTEEF
NISMDQFVQQVAHGNEEIGDAILTIELILIQELNFHLTIHNPFRPLEGFLIDLKTRYRNL
ENAEQLRKPAKDFLVRSLNTDVGLLYAPSQLALAALLSAASMRNLNIDRYVTSVLLVGQP
QTVLEQTIQRIKKIRTIVKNAVSAPLPSDQIEILEQKLSHCYNKEKDPTSYEYSCLQQEI
ESQKYDKQTKKRKLEHERRRKIETELLGF
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgtttaactcaagcacacagttaaagaattggacgtttgaacatgaagaagaattgata
aagttaagaaataatgcaaacacgaagtacagaacgagttactgcgatgtaaacaatcat
gtgacaccagacgctgatactttttttctcactgtgagtgaacactgtttcctagtccaa
cattacgaacgtaaattgcaagaaatttgttggaaatttaaacccccaatgccacttaat
gttgttggaacgtcttgtatgtatttgaagagattaaaccttcgcaagtctgttatggac
taccatccaaggctaatgcatttagcttgtatttggctagcttgtaagacagaggagttt
aatatatctatggatcagtttgtgcagcaagttgcacacggcaatgaagagattggtgat
gctattcttactattgaactaattctaattcaggagttaaacttccaccttaccattcac
aacccattccgacctttagaaggatttcttattgatttaaaaactcggtatcgaaattta
gaaaacgctgaacaactgagaaagccggcaaaggattttttagttcgttcgttaaacact
gacgttggacttttatacgcaccctcacaactagcactggctgctctgctctctgctgcc
tccatgaggaatttaaacattgaccgttacgtcacatcagttttgttggttggccagcca
cagacagtacttgaacagacaattcagcgaattaaaaagattcgaaccattgtaaaaaat
gctgtgtcggcgccgttgcctagcgaccaaattgaaattttggagcaaaagctgagtcat
tgttacaacaaggaaaaagacccgactagttacgagtactcttgcttacaacaagaaatt
gagtcgcagaaatatgataaacaaacaaagaaaaggaaacttgagcatgaacgaagacgg
aaaattgaaactgaattattaggattttga

DBGET integrated database retrieval system