KEGG   Ciona intestinalis (sea squirt): 100177816Help
Entry
100177816         CDS       T01056                                 

Definition
cyclin-H-like
Orthology
K06634  
cyclin H
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Basal transcription factors
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:cin00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    100177816
  Replication and repair
   03420 Nucleotide excision repair
    100177816
Transcription machinery [BR:cin03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     100177816
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 329 aa AA seqDB search
MFNSSTQLKNWTFEHEEELIKLRNNANTKYRTSYCDVNNHVTPDADTFFLTVSEHCFLVQ
HYERKLQEICWKFKPPMPLNVVGTSCMYLKRLNLRKSVMDYHPRLMHLACIWLACKTEEF
NISMDQFVQQVAHGNEEIGDAILTIELILIQELNFHLTIHNPFRPLEGFLIDLKTRYRNL
ENAEQLRKPAKDFLVRSLNTDVGLLYAPSQLALAALLSAASMRNLNIDRYVTSVLLVGQP
QTVLEQTIQRIKKIRTIVKNAVSAPLPSDQIEILEQKLSHCYNKEKDPTSYEYSCLQQEI
ESQKYDKQTKKRKLEHERRRKIETELLGF
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgtttaactcaagcacacagttaaagaattggacgtttgaacatgaagaagaattgata
aagttaagaaataatgcaaacacgaagtacagaacgagttactgcgatgtaaacaatcat
gtgacaccagacgctgatactttttttctcactgtgagtgaacactgtttcctagtccaa
cattacgaacgtaaattgcaagaaatttgttggaaatttaaacccccaatgccacttaat
gttgttggaacgtcttgtatgtatttgaagagattaaaccttcgcaagtctgttatggac
taccatccaaggctaatgcatttagcttgtatttggctagcttgtaagacagaggagttt
aatatatctatggatcagtttgtgcagcaagttgcacacggcaatgaagagattggtgat
gctattcttactattgaactaattctaattcaggagttaaacttccaccttaccattcac
aacccattccgacctttagaaggatttcttattgatttaaaaactcggtatcgaaattta
gaaaacgctgaacaactgagaaagccggcaaaggattttttagttcgttcgttaaacact
gacgttggacttttatacgcaccctcacaactagcactggctgctctgctctctgctgcc
tccatgaggaatttaaacattgaccgttacgtcacatcagttttgttggttggccagcca
cagacagtacttgaacagacaattcagcgaattaaaaagattcgaaccattgtaaaaaat
gctgtgtcggcgccgttgcctagcgaccaaattgaaattttggagcaaaagctgagtcat
tgttacaacaaggaaaaagacccgactagttacgagtactcttgcttacaacaagaaatt
gagtcgcagaaatatgataaacaaacaaagaaaaggaaacttgagcatgaacgaagacgg
aaaattgaaactgaattattaggattttga

  All links  
No link information was found.   
DBGET integrated database retrieval system