KEGG   Ciona intestinalis (sea squirt): 100177890Help
Entry
100177890         CDS       T01056                                 

Definition
delta-aminolevulinic acid dehydratase-like
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cin00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 337 aa AA seqDB search
MTESSFKNYLHSSIHHPTLRAWNSIPSTLNADNFMYPVFITDTSDAAYEPIPSLPEQARH
GVDHLVKYLAPLVQGKDCLPLKAVLVFGVPTQIKKDGCGSAADDEMGPVIRGIKKLRKAF
PNLLVAADVCLCAYTDHGHCGILNENGTINNPPSIKRLAEVAVNYAKAGAHVVAPSDMMD
CRIKAIKHGLHEAGLAGCTTVLSYSAKFSSCFYGPFRDAAQSAPSFGDRKCYQLPPGSRG
LAIRAADRDVQEGADMLMVKPGMPYLDIIFEIKQKYPHHTMAAYHVSGEYAMLCHGASNG
ALDLKSAVLESFSSLRRAGTDVIITYFTPRVLKWLKE
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgactgagtccagcttcaaaaactacttgcatagttcaatacaccaccccaccttaaga
gcatggaattcaataccttcaacattaaatgcagataacttcatgtatcctgtctttatc
actgataccagtgatgccgcttatgaaccaattccatctttacctgagcaagcaaggcat
ggtgtggaccatttagtaaagtatctggcaccactggttcaagggaaagactgcctgcca
ttaaaagctgttttggtgtttggggtcccaacccagataaagaaggatggttgtggtagt
gcagctgatgatgaaatgggacccgttatacgaggaattaaaaaacttagaaaagctttt
cctaatttgcttgttgctgcagatgtatgtttgtgtgcgtatacagatcatggtcactgt
gggattttgaatgaaaatgggacaattaacaatccaccaagtattaaaagattagcggaa
gtagctgtgaattacgccaaagctggagctcatgttgtcgcaccgagtgatatgatggat
tgtaggattaaagcaataaaacatggactacatgaagctggtttagctggctgtaccact
gttctaagctacagtgcaaagttttcctcctgtttttacggccctttccgtgacgctgct
caatccgcaccaagttttggtgatcgtaaatgttaccaacttcctccaggttcgaggggc
cttgctattcgtgcagctgatcgggatgtacaagaaggtgctgatatgctaatggtcaaa
cctggcatgccatacttagacatcatctttgaaatcaagcagaaatatccccaccacacg
atggcagcataccatgtatctggggagtatgcaatgttatgccatggggccagtaatggg
gctctggatctaaaatctgcagttttggaaagcttttcttcactgagaagagcgggaaca
gatgtgataatcacctatttcaccccaagagttctgaaatggttaaaagaatga

DBGET integrated database retrieval system