KEGG   Ciona intestinalis (sea squirt): 100177924Help
Entry
100177924         CDS       T01056                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
cin01100  Metabolic pathways
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 100177924
NCBI-ProteinID: XP_002130640
UniProt: A0A1W2WN41
Position
3
AA seq 119 aa AA seqDB search
MDETSQTGDIEKGKKIFIRKCKQCHTYEDNGKHKTGPNLFGLIGRRTGQSPGYTYTVSNT
EKGIIWNEETLDIYLTNPRKYIPGTKMIFAGISKRSERIHLIAFLKKVTTTETETKTCN
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atggatgaaacaagtcaaactggagatatcgaaaaaggaaaaaagattttcatacgaaag
tgtaagcagtgccatacctacgaagataatggaaaacacaaaactggtccaaacctgttt
ggtctgattggaagacgcactggtcagtctccaggctacacatacactgtgtcaaacaca
gaaaaaggaataatttggaatgaagaaactctggatatttacttgaccaacccaaggaaa
tatattccaggcacaaaaatgatatttgccggaatttcaaagcgttctgaacgcatccat
ctgattgcatttttaaaaaaagtaacaaccacagaaactgaaacaaaaacctgcaactga

DBGET integrated database retrieval system