KEGG   Ciona intestinalis (sea squirt): 100178056Help
Entry
100178056         CDS       T01056                                 

Gene name
sf3b3
Definition
splicing factor 3B subunit 3-like
Orthology
K12830  
splicing factor 3B subunit 3
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Spliceosome
Module
Spliceosome, U2-snRNP
Brite
KEGG Orthology (KO) [BR:cin00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    100178056 (sf3b3)
Transcription machinery [BR:cin03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100178056 (sf3b3)
Spliceosome [BR:cin03041]
 Complex A
  U2 snRNP components
   U2 snRNP specific factors
    100178056 (sf3b3)
 Complex B
    100178056 (sf3b3)
 Complex C
   U2 SnRNP specific factors
    100178056 (sf3b3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 1216 aa AA seqDB search
MFLYGLTLQRATTIIHAVHGNFSGTKQQEIAVSRGKLLELLKPDPNTGKVHTLITVEVFG
EIRSLMSFRLTGGNKDYVVCGSDSGRISILEYIPNKNKFEKIHLETFGKSGCRRIVPGQY
LAIDPKGRAVMIGALEKQKLVYILNRDSQARLTISSPLEAHKANTFVYHMVGIDVGFENP
MFACLELDYEEADTDPTGEAVQNTQQTLTFYELDLGLNHVVRKYSEPLEERANHLISVPG
GNDGPGGVLVCAENYITYKNFGDQPDIRTPIPRRRNDLDDPERGMIVVCSATHKTKSMFF
FLIQTEQGDIFKVTLETDEDMVTEIRLKYFDTVPVSMAMCVLRTGFLFVAAEMGNHCLYQ
IAHLGDDDDETEFSSAMPLEEGDTFFYAPRALRNLVLVDELDSLSPIMTCLISDLANEDT
PQLYVTCGRGPRSSLRVLRHGLEVSEMAVSELPGNPNAVWTVKIKEEEEFDSYIIVSFVN
ATLVLSIGETVEEVTDSGFLGTTPTLSCSLLGENALVQVYPDGIRHIRADKRVNEWKTPG
KKTILRCAVNQRQVVIALTGGELVYFEMDQSGQLNEYTERKEMNSEVVCMDLSKVPPTEQ
RTRFLAVGLADNTVRIISLDPTDCLQPLSMQALPATPESVCIIEIGGGEDETGAQKASGG
LVLNIGLQNGVLLRTTLDNVTGDLSDTRTRYLGTRAVKLFRVLTQGSDAVLAMSSRTWLS
YQHQNRFHLTPLSYESLEFASGFASEQCPEGIVAISANTLRILALEKLGTVFNQASTGLQ
YTPRRFAIHYDSGNVIILETDHNAYTEETKENRKQQMAEEMIEAAGEDERELAAEMTAAF
LRESLPEDKFGASKAGPGMWSSQIRLMHPRSGETIQKICLEQNEAALSIAICKFPNNSDD
TFVLVGVACELLINPRQARGGGEIHTYKINEEGNKLELVHKTVVDEVPSAICPYQGRVLI
GVGKLLRIYDLGKKKLLRKCENKHIPNYIASIQAVGHRIIVCDVQESVHWVRYRRHENQL
VVFADDTYPRWVTSATVLDWNTVAVSDKFGNISVLRLPSDVNDDVQDDPSGTKALWTRGI
LNGAMQKCEVLCMYHVGETVLSLQKTTLIPGGSESLVYTTLSGSIGMLVPFTSHEDHDFF
QHLEMHMRNECPPLLGRDHLAYRSYYFPVKNVIDGDLCELFNSMEASKQKSVAEELDRVP
SEVSKKLEDIRTRYAF
NT seq 3651 nt NT seq  +upstreamnt  +downstreamnt
atgtttttgtatgggctgactctgcaaagagctaccaccattattcatgcagtccatggc
aacttttcggggacaaaacagcaggaaattgccgtttccagagggaaactgctggagttg
ttgaagccagatccaaacacagggaaggtgcacacactcatcactgttgaggtgttcgga
gaaattcgttctttgatgtcgttccgcttgactggaggcaacaaagattacgttgtgtgc
ggttcagattctggaagaatttctatccttgaatatattccaaataaaaataaatttgaa
aagattcacttggagacttttggtaaaagtggatgcagaaggattgtacccggtcaatat
cttgctattgatcccaaaggaagagctgtaatgatcggtgctttggagaagcagaagttg
gtttacattttgaatcgagactcacaagcaaggttgaccatctcgtctccgctcgaagct
cataaagcaaacacattcgtctaccacatggtggggatagacgtggggttcgaaaatcca
atgtttgcttgtcttgaacttgattatgaagaagcagataccgacccaactggcgaagct
gttcaaaatacacaacagaccttaaccttctatgagcttgaccttggtttaaaccatgtg
gttcgaaaatacagcgagcccctggaagaacgagccaatcatcttatatcagtgcctggt
ggtaatgatggtcccggtggtgtgttagtgtgcgcagagaactatatcacatacaagaac
tttggtgaccaacctgatattagaacccctattccaagaagaaggaatgatcttgatgat
ccagagcgaggcatgattgtggtatgcagtgcaactcataaaacaaagtcgatgtttttc
tttttaattcaaactgaacaaggagatatatttaaggtgacccttgaaacagatgaagac
atggtgaccgagattcgacttaaatattttgacactgttcccgtttccatggcgatgtgt
gtgttgagaactggtttcttattcgtggctgctgagatgggaaatcattgtttataccaa
attgctcaccttggagatgacgatgatgagacggagttctcgagcgcgatgccgttagag
gaaggagacacattcttctacgctcctcgtgcgctgaggaaccttgtgctcgttgacgag
ctggacagcttgtcaccaatcatgacttgcctgatatcagatcttgcaaatgaagacacc
ccacagttgtatgtaacttgtggtagaggtccacgttcatctcttcgtgttttaaggcac
gggcttgaggtttccgagatggctgtttcagaactacctggtaatccgaatgctgtgtgg
actgtaaagataaaagaagaagaggaatttgattcttacatcatcgtgtccttcgtcaac
gctacccttgtcctctctatcggagaaactgttgaagaagttacagattctggattctta
ggaacaactcccactctatcttgctcattgctgggtgagaatgcattggttcaggtttac
ccggatggtattcggcacatccgagctgacaagcgagtcaatgaatggaaaactccgggt
aaaaaaaccatcctgaggtgtgctgtcaatcaaagacaagttgtcatcgcacttactggg
ggggaacttgtatattttgaaatggatcagtcaggacaactgaatgaatacacggaacgt
aaagagatgaacagcgaggttgtgtgcatggatttatcaaaagttcctccaacggaacaa
agaacgcgatttcttgctgtcgggttggctgataatactgtccgtattatatctcttgac
ccaactgattgtttgcaacctctgagcatgcaagctcttcctgcaactccggagtcggtt
tgcatcattgaaatcggaggaggagaggatgaaacaggagcacagaaagcatccggagga
ttggtcctcaacattgggttgcagaacggggttttgcttcgaacaacgcttgataatgtg
acaggagatctctcggacacacgaacacgatatcttggaacacgggcagtcaaactgttt
cgtgtattgacacagggttcagatgcagtattagcaatgtccagcagaacatggttaagt
tatcaacatcagaacaggttccatctcacaccactatcttatgaaagcttggagtttgca
tcaggattcgcatcagagcaatgtccagaaggaattgttgcaatatctgccaacaccctc
aggattttagcattggagaagttgggcaccgtgttcaaccaagcgtccacaggacttcaa
tacacgccacgtagatttgcaatacattacgactcgggtaatgtcattatacttgagacc
gatcataatgcttacacagaagaaaccaaggagaacagaaaacaacaaatggcagaagaa
atgatagaggcagcaggtgaggatgagagagaactcgctgctgagatgaccgcagctttc
ctccgtgagagtcttccggaggataagttcggagcatcaaaagctggtcctgggatgtgg
tcatctcagatccgtctcatgcatccaagatctggcgaaacaattcaaaaaatttgtctg
gagcaaaacgaagcagcgttgagcattgctatttgtaagtttcccaacaacagtgacgac
acgtttgtgttggttggcgtggcttgcgaactccttatcaacccacggcaagcaaggggg
ggaggggagatacatacttataaaataaatgaagaaggaaataaactggaactcgtgcat
aagacagtagttgacgaggtgccgagcgcaatttgtccgtatcaaggtcgtgtcctcatc
ggggttggaaagttgcttcgaatctatgatcttgggaagaagaagttgttgaggaagtgt
gagaataagcacatccctaactacatagccagcattcaagctgttggtcatcgtatcatt
gtgtgcgatgtacaggagtctgtgcattgggtgagatatcgaagacatgaaaaccaactt
gtggtgtttgcggacgatacttacccacgatgggtcacgtcagctactgtgttggattgg
aacacagtggctgtgtccgataagtttggaaatatatctgtgctgcgtcttccatctgat
gtcaacgatgacgttcaagatgatcccagcggaaccaaagctttgtggacgagaggaatt
cttaacggagcaatgcagaagtgtgaggtgctatgcatgtaccatgttggggaaacagtt
ctatcactacagaagaccaccctcatacctggaggttcagaatccctcgtatacaccaca
ttatcgggtagtattggtatgttggtgccattcacatcacatgaggatcatgatttcttc
cagcatttagaaatgcacatgagaaatgaatgtccaccattattggggagagaccatctt
gcttatagatcatattactttcctgtcaagaatgttattgatggtgatttgtgtgaactc
ttcaattcaatggaggcttcaaaacaaaaatctgtagctgaggaattagacagagtccca
tctgaggtgtcgaaaaaacttgaagacattcgtacaagatatgcgttctga

DBGET integrated database retrieval system