KEGG   Ciona intestinalis (sea squirt): 100178187Help
Entry
100178187         CDS       T01056                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase-like
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
cin  Ciona intestinalis (sea squirt)
Brite
Enzymes [BR:cin01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     100178187
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
14
AA seq 240 aa AA seqDB search
MLVLFIICTMAWRCHGKSNLDLINNLRKNGIITHDAVYEGMKLTDRKFYVSSGAYNDSPQ
SIGYQATISAPHMHAAALEALHDQLTRSENPTALDVGSGSGYLTACFARMMGDNGRAYGI
EHIPELVNKSIENVNRDDSTLITSGRVTLKKGDGRLGYDPDNRKTELYDAIHVGAAASQV
PRPLLEQLKKGGRLILPVGEPGTTQVFEQWDKNNVGELTKKELMKVVYIPLTDKRKQWPG
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgttggtgttattcataatttgtacaatggcgtggcgctgtcatggaaaaagtaacttg
gatttaattaacaacctcagaaaaaatggaattattacccatgatgcagtttatgaaggt
atgaagttgacggaccggaaattttatgtttcaagtggggcatataatgacagtccacag
tctattggataccaggctactataagtgcaccccacatgcatgctgcagctttagaggcg
ttacatgatcaacttaccagaagtgagaatccaacagcattagatgttgggtctggtagc
ggatatttaacggcttgttttgcgagaatgatgggagataatgggagagcttatgggatt
gaacatattccagaacttgtgaataaatccattgaaaatgtaaacagagatgactcaact
ttgattacttctgggagggttactttgaaaaagggggatgggagactgggttatgacccg
gacaatagaaagacagagctttatgatgcaatacacgtcggagcggctgcttctcaagta
cctaggcctttacttgaacaattgaaaaaaggtggccgacttattttgcccgtgggagag
cctggtacaacacaagtatttgagcaatgggacaaaaataatgttggtgaacttaccaag
aaagaattgatgaaagttgtttacattccacttactgataagcggaaacagtggccaggt
tga

DBGET integrated database retrieval system