KEGG   Ciona intestinalis (sea squirt): 100178190Help
Entry
100178190         CDS       T01056                                 

Definition
calcineurin B homologous protein 1-like
Orthology
K17610  
calcineurin B homologous protein 1
Organism
cin  Ciona intestinalis (sea squirt)
Brite
Protein phosphatases and associated proteins [BR:cin01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100178190
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
11
AA seq 189 aa AA seqDB search
MGSKASLHLREEEIEAIQQETGFQSNQIIRLFSRFTCLDKEQNGFLTRDDFMRIPELAIN
PLADRIVDAFFNGGEEHVNFRQFMRTLANFRPSSAKTAEDSPNSRTNKLKFVFSLYDYDS
DGMISKKELLQILKLLVGANINQDQLSHIAERTLLESDTNNDRHISFEEFKTVMARTEID
TKMSVRFLD
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggggtctaaagcatctttgcatttaagagaagaagaaattgaagcaattcaacaagaa
acagggtttcaatcaaatcaaatcattcgtctattcagtcgctttacttgccttgataaa
gaacaaaatggttttctaactcgtgatgattttatgagaataccagaacttgcaattaat
cctcttgcggatagaatagttgatgctttctttaacggaggggaagagcatgtcaacttt
cgacagtttatgagaactcttgcaaactttcggccaagcagtgcaaaaacagcagaagat
tcaccaaacagtagaacaaataagttaaaatttgtattctcgttgtacgattatgatagt
gatggaatgatatcaaagaaagagttgctgcagattctcaagttactggttggagcaaat
ataaatcaagaccaactttcacacattgctgaacgaactttgttagagtcagacacaaac
aatgaccgtcatatcagctttgaggagtttaaaactgtaatggctcgaacagagattgac
accaaaatgagtgttcggtttttggattga

DBGET integrated database retrieval system