KEGG   Ciona intestinalis (sea squirt): 100178258Help
Entry
100178258         CDS       T01056                                 

Definition
serine/threonine-protein kinase pim-3-like
Orthology
K08807  
proto-oncogene serine/threonine-protein kinase Pim-3 [EC:2.7.11.1]
Organism
cin  Ciona intestinalis (sea squirt)
Brite
Enzymes [BR:cin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100178258
Protein kinases [BR:cin01001]
 Serine/threonine protein kinases: CAMK group
  PIM family [OT]
   100178258
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 326 aa AA seqDB search
MLSFQKKMHLGNMQSTSQQQIQAAAKSASAQREPFERAYQVGKVLGSGGFGVVYAGIRAV
DNLPVAIKHIARSRVKVWGQLNGQVVPNEIVLMDRISPCDQVIKLIDWYERPDSYIIIME
RPEPCQDLFDYITEKKALDEDTARTFFWQVLLAVDHCHKCGVVHRDIKDENLLVDFRNKS
LKLIDFGSGAILRDTVYVEFDGTRVYSPPEWITKHRYHGRSATVWSLGILLYDMVCGDIP
FEKDEDIENAKVHFTRQVSPECEDLIRSLLSFRPADRPTIEQIMVHSWILKGDFISRHCG
TVGSHIRTSSECSDGGSSTDSTESFK
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgttatcgtttcagaaaaagatgcatttgggaaatatgcaatcaacaagccaacagcaa
atacaagctgcagcaaaatcagcatcagcgcaacgagaaccgtttgaaagagcctaccaa
gttgggaaagttctcggttctggtgggttcggtgtggtttacgctggtattcgggcagtg
gacaacctacctgttgcaatcaaacacattgcccgatcacgcgtaaaggtttggggacag
cttaacggccaggtggttccgaacgaaatcgtgctgatggatcgcattagcccttgtgac
caagttatcaagcttattgactggtacgaacgacccgacagttatatcatcatcatggaa
cgacccgaaccatgccaggatttatttgattacataactgaaaagaaagcattggacgag
gacacagcgcgtacattcttctggcaggttttgctagccgtggatcattgccacaaatgc
ggcgtcgttcaccgagacattaaggacgagaacttgctcgtggacttcaggaacaaaagc
ttaaaattgatcgactttggatcgggcgccatcctccgcgacaccgtctacgttgaattc
gacggaacccgtgtctactctcctccagaatggatcacgaagcatcgctaccacggtcgt
tccgctaccgtgtggtccctcggcatccttctgtacgacatggtgtgcggtgatatcccc
ttcgaaaaagacgaagacattgaaaacgcaaaagttcacttcacgaggcaggtctcacca
gaatgcgaagacctcattcgatccttactttccttccgacctgcagatcgccccaccata
gaacaaatcatggtgcattcctggatcttaaaaggcgactttatttcaagacactgcggt
accgtcggcagccacataagaactagctccgaatgttcggacggtggcagctcaaccgac
agcacggaaagcttcaaataa

DBGET integrated database retrieval system