KEGG   Ciona intestinalis (sea squirt): 100178259Help
Entry
100178259         CDS       T01056                                 

Definition
clathrin heavy chain 1-like
Orthology
K04646  
clathrin heavy chain
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Lysosome
Endocytosis
Brite
KEGG Orthology (KO) [BR:cin00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100178259
   04142 Lysosome
    100178259
Exosome [BR:cin04147]
 Exosomal proteins
  Proteins found in most exosomes
   100178259
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
12
AA seq 1686 aa AA seqDB search
MAQNLPIKFQEHLQLQNVGINAANIGFSTLTMESDKFICVREKVADQAQVVIIDLADSAN
PIRRPISAESAIMNPASKVIALKAGRTLQIFNMEMKSKLKAHTMTEDVVFWKWISTNMVG
LVTETSVYHWSMEGDSQQPVKMFDKHPSLAKCQIINYRTDAKQKWLLLIGISAQANRVVG
AMQLYSVERRVSQPIEGHAASFAQIKLEGNKEESTLFCFAVRGPQGGKLHIIEVGSPAAG
NQPFTKKAVDVFFPPEAANDFPVAMQVSPNQNVVFVVTKYGYIHMYDLETAVCIFMNRIS
ADTIFVTAPHEATGGLIGVNRKGQVLSVSVDEENVVPYITNTLQNPDLALRFAVRNNLGG
ADELFSRKFNTLFAQGNYTEAAKVAANAPKGILRTSQTIQKFLSVPAQPGQNSPPLLQYF
GILLDQGKLNKFESLELCRPVLQQGRKHLMEKWLKDEKLECSEELGDLVKPVDSTLALSI
YLRATIPNKVIMCFAETGQFQKIVMYAKKVGYTPDYVFLLRNVMRVNPETGKQFAMMLVQ
DDEPLADVAQIVDVFMEQNLIQQCTAFLLDALKNNRPAEGALQTRLLEMNLMHAPQVADA
ILGNQMFTHYDRAHVAQLCEKAGLLQRALEHFVDLYDIKRAIIHTHLLNPEWLVNYFGSL
SVEDSLECLKAMLTANIRQNLQICVQVATKYHEQLTTEKLIEVFESFKSFEGLFYFLGSI
VNFSQDPDVHFKYIQAACKTGQIKEVERICRESNCYDADKVKNFLKEAKLTDQLPLIIVC
DRFDFVHDLVLYLYRNNIPKYIEIYVQKVNPSRLPVVVGGLLDVDCQEDTIKNLIMVVRG
QFSTDELVEEVEKRNRLKLLLPWLESRVHEGSEEPATHNALAKIYIDSNNNPERFLRENP
FYDSRVVGKYCEKRDPHMACVCYERGQCDDELIRLCNENSLFKSEARYLVRRKDVELWGK
VLEDTNQYRRQLIDQVVQTALGEAQDPDEISVAVKAFMAADLPNELIELLEKIVLDNSMF
SDHRNLQNLLILTAIKADSSRVMDYITQLDNYDAPDIANICIENELFEEAFAIFNKFDVN
TSAISVLIEHVKNLDRAYEFAERCNEPTVWSQLARAQLNSGMIKEAIDSYIKADDPSSYM
EVVEASNKSENWEDLVRYLQMARKKARESYVETELVFAFAKTNRLADLEEFISGPNNANI
QQVGDRCYDQKMYEAAKVLFNNISNFARLASTVVHLGEYQTAVDSARKANSTRTWKEVCF
ACVDGEEFRLAQICGLHIVVHADELEELINYYQDRGYFEELITMLEAALGLERAHMGMFT
ELAILYSKYKPGKMREHLELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDNAIVTM
MAHPTDAWKEGQYKDIITKVANIELYYKSLQFYLDYKPMLINDLLNVLSPRMDHTRAVAF
FRKVQHLPLVKPYLRTVQTHNNKAINEALNDLLIEEEDYSGLRNSIDAYDNFDTIALAQR
LEKHELIEFRRIAAYLYKGNNRWKQSVELCKKDLLYKDAMTYAGESRDTELAEELLEWFL
ERQRYECFSAGLYSCYDLLRPDVVLEQAWRHGISDYAMPYLIQVMREYTIRIDKLETSEN
VRKQEEEQTENKPIVYDNPTLMITAGPSYPQPGYAAPQMPGMPGGMPPAGMQGPPGMMGG
GYNFGM
NT seq 5061 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaaatctccctattaaatttcaagaacatcttcagcttcaaaatgttggcatc
aacgcagcaaatatcgggttctccactcttacaatggaatcagataaatttatttgtgtg
cgagaaaaagtggctgatcaggctcaggttgtcattattgatcttgctgactcagcaaat
ccgattcgaagacctatttctgctgagtcagcaatcatgaaccctgcaagcaaagtaatt
gccttgaaggcgggtcgcacacttcagatttttaacatggaaatgaaatcaaaacttaaa
gctcacaccatgacagaagatgtggtgttttggaagtggatatcaaccaacatggttggt
ttggtcactgaaacctctgtatatcactggagcatggaaggagattcccaacaaccggta
aaaatgtttgacaaacatccaagtcttgccaaatgccagatcattaactacaggacggac
gctaaacaaaagtggttgctactgattgggatttccgcacaagccaatcgagtggtgggt
gcaatgcaactctactcagttgaacgcagagtcagtcagccaattgaaggacatgctgca
tcttttgctcaaattaaacttgaaggaaataaggaagaatcgaccctcttctgttttgct
gtaagaggaccacaaggaggcaaacttcatatcatcgaggttggatccccagctgcaggc
aaccaaccattcaccaagaaagctgtcgacgttttttttccaccggaggccgctaatgat
ttccctgttgcaatgcaggtttctccaaaccagaatgtggtgtttgtggtgactaaatac
ggatacattcatatgtatgatcttgaaactgctgtatgcatctttatgaaccgaatcagt
gccgataccatcttcgtcactgctcctcatgaagctactggaggacttattggagtcaac
agaaagggacaggttctatcagtttctgtagatgaggaaaatgtggtgccgtacataacc
aacactttacaaaaccctgacttagctcttcgttttgctgttcgtaacaatcttggtggt
gcagatgaactcttctctagaaaattcaacacattatttgcccaaggcaactacactgag
gcggccaaagttgctgcaaatgctccaaaaggtatcctgaggacttcccaaaccatccag
aagtttctctccgtgcctgcccaaccaggccaaaactctccaccattgttgcaatacttt
ggcattctattggaccagggcaaactgaacaaatttgagtcactggagttatgtagaccg
gtgcttcaacaaggcaggaaacatctgatggagaaatggttgaaggatgagaaacttgaa
tgttctgaagagcttggagatctcgtgaaacctgttgattcaactcttgccctgtctatc
tacctcagggcaactattcctaataaggtgatcatgtgttttgcggagacggggcaattc
cagaagattgtgatgtatgcaaagaaggtcggttacactcccgattatgtcttcctcctc
cgtaatgtgatgcgggttaatccggagacgggaaaacagtttgcgatgatgttggtacaa
gatgatgagccactcgcggatgttgctcagattgtggatgttttcatggaacaaaacctc
atccaacaatgcactgcgttcctccttgatgcattgaagaataatagaccagcagaagga
gctctgcagacacgtctgcttgagatgaacctcatgcacgccccacaggttgcggatgcc
attcttggcaaccagatgttcacccattacgatcgtgcccatgttgcgcaactatgtgag
aaagccggtctgttgcaacgagcgcttgaacattttgtggacctctatgatattaaacgt
gccatcatccacacacatctgcttaaccctgaatggttggtcaactacttcggcagcttg
tcagttgaagattccttggaatgcttgaaggcaatgttgacagctaacattcgacagaat
ctacagatttgtgttcaagtggcaacaaaataccatgagcaacttacaactgaaaagctg
attgaggtttttgaatcctttaaaagcttcgaaggtttattttacttccttggatcgatt
gtgaacttcagtcaagatcctgatgttcacttcaaatacatacaagcagcttgtaagaca
ggtcagatcaaggaagtcgagaggatttgtcgtgaaagcaactgctatgatgcggataag
gtgaaaaacttcttaaaagaagccaagttgacggatcaacttccattgatcatcgtgtgc
gatcgatttgactttgttcacgatctcgtcctctatttgtatcgcaacaacataccaaag
tatattgagatctatgtgcagaaggtgaatccttctcgtctcccagttgttgtcggagga
ttgttggatgttgattgtcaggaggacaccatcaagaacctgatcatggtcgtcagagga
caattctctacagatgagcttgtggaagaagttgagaagagaaacaggctaaaacttctt
cttccatggttggagtcgcgtgtgcatgaaggatccgaggaaccagctacccacaatgca
cttgctaagatctacatcgattcaaacaataaccccgagcgattcttgcgtgagaatcca
ttctatgatagtcgagtggttggtaaatactgcgagaagcgagatccacatatggcttgc
gtttgctacgaacgtggccagtgtgatgatgaacttatcaggctttgcaatgaaaactcc
ttgttcaaatctgaagctcgatatttggtgagaagaaaggacgttgagttgtggggaaaa
gttttggaagatacaaaccaatacaggaggcaacttattgatcaggtggtacagacagca
cttggtgaagcacaagacccagatgaaatctcggttgccgtgaaagctttcatggcagcg
gatcttccaaatgaactcattgagttgttggagaagatcgtgttggataattcaatgttt
tccgatcacaggaacctccagaacctcttgattctcactgcgatcaaagctgacagctct
cgtgtgatggattacatcactcaacttgataattatgatgctccagatatcgcaaatatt
tgcatcgaaaacgaactcttcgaggaagcattcgcgatatttaacaagtttgacgtcaac
acttctgcaatctctgttttgatcgagcatgtgaaaaacctcgaccgtgcgtatgagttt
gcggaacgttgcaacgagcccaccgtgtggtcacaactggcacgagctcagttgaactcg
ggaatgataaaggaagcgattgattcttacatcaaagctgatgatccaagctcttacatg
gaggtggtggaagcttcaaataaatccgagaattgggaggatttggttcgttacttgcag
atggctcgtaagaaggcacgagaatcttatgttgagactgaacttgttttcgctttcgct
aaaaccaatagactcgcagatcttgaagagtttattagtggcccaaacaatgccaacata
caacaggttggagacagatgttacgatcaaaagatgtacgaggcagccaaggttctcttc
aacaacatctccaactttgctcggctcgcatccacggtcgtccacctcggtgaatatcaa
actgctgttgattccgcacgtaaagccaactccacacgaacatggaaggaggtttgcttt
gcttgtgttgatggtgaagagtttcgtctcgcacaaatatgtggccttcacattgttgtt
catgctgatgaattggaagaacttattaattactaccaggaccgcggatactttgaagag
ttgatcacgatgttggaggctgctcttggacttgagcgtgctcacatggggatgttcacg
gaacttgccatcctttactccaagtataaaccagggaagatgagagaacatctggaactt
ttctggtcaagagtcaacatccccaaggttcttcgagctgcagaacaagcacacttgtgg
gcagagttggtgttcctgtatgacaaatatgaggaatatgataacgccattgttaccatg
atggctcatcccaccgatgcatggaaagaaggacaatataaagatattataaccaaggtt
gccaacattgagctctactacaaatccctgcagttttatctggactacaaacccatgctt
ataaacgacttactcaacgtattgtcaccacgtatggaccacacaagagctgttgctttc
ttcaggaaagttcaacatttgccactcgtcaaaccatatctgcgtaccgtgcagacacac
aacaacaaggcgataaatgaggcattgaatgatcttcttattgaagaagaggattactct
ggtcttcgcaactccattgatgcgtatgataactttgacaccattgctcttgcacaacgt
ttagagaaacacgagttgattgagttccgtcgtattgcagcatacttatacaaaggaaac
aacagatggaagcaatctgttgagttgtgcaaaaaagatctgctctacaaggatgcaatg
acatatgcaggggaatcccgggacacagagttggcagaggaattgttggagtggttcctt
gaaagacagagatacgaatgtttctctgctggactttattcctgttatgacttgcttcga
cctgatgttgtattggaacaagcatggagacatggaatcagtgattatgcaatgccatat
cttattcaagtcatgagagagtacacaataaggattgacaaacttgaaacatcggaaaat
gtgagaaaacaagaagaagaacaaacagaaaataagccgatcgtatacgataaccccacc
ctaatgatcaccgctggaccctcctatccacaacctggctatgctgctcctcagatgcca
gggatgcctggaggaatgcctcctgctggtatgcagggacctcctggcatgatgggtggt
ggctataacttcgggatgtaa

DBGET integrated database retrieval system