KEGG   Ciona intestinalis (sea squirt): 100178360Help
Entry
100178360         CDS       T01056                                 

Definition
(RefSeq) uncharacterized LOC100178360
  KO
K11427  
histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100178360
Enzymes [BR:cin01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100178360
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 1267 aa AA seqDB search
MSKGNENEIRVLRLKSPAGAEAAIYKWPLPKYETRDGAFEIIDTIRWVCKDYPDLEMAME
KHILADYDTKNFESMKELCNKYNRAIDSILQLWQGTSKSALLQTQPSTGLLKHIMQQVYN
HSVLEPEKLNQYEPFSPEVYGETSFDLISQMLCELKLKDDDVFLDLGSGVGQVVLQVAAA
SPCKLCLGIEKAPLPGKYSQNMDKEFRKWMRWYGKKYRPYKLETGDFLEEEWKDRIASAT
VIFVNNYAFGPEVDHQLKERFANLKEGSKIVSSKAFAQVNFRITDRNLTDIGTILRVSVL
SPLRGSVSWTPNPVTYYLQVVDRTMLERYFLAQTDPKLREELDMEHRRSKDNSPALSMYR
SLGKENAKPVSDHITEKDVKDSKKSNNFKKSSISPNNTKKHQRILSTSDSDAQADSDFGE
AGITVGSLASDSSDDFAPPIKKKGLGGHKRSRSKSFLKTNKMRVKPEKNVKVEEISESDH
RSKRARRSGRRPATKCVRSSLSTPTSTGLDNAKLMKPINKRAMDNHNAIQLLHEVTVGSD
VRDPGDYVNMSLLSKPIITTGSSHASSNLKDKQLYALDFMFERWKMRVLRLMCDSVGDVF
SERLQTQYTVETKKNEHLKMLNKMFCADVERLKERTLMLIQTRLNDLQVEFKSPTTLHAR
NGDNHHDTIQHLQQLHFHISKNITNDTAKSSNQSLSNHQQLQNVLHDALLYLEQSENPNM
EYMRHGNLHYSNSANNEKLLGPMHGAPASTYRPLGGLPVQIEASTGHQASNSPQSPKETG
QTSNSKRKPHIHRRTELPAEAMQIVQQVLDNYREGRQCSLEGNQKKLLKHKTLDPKHNSI
HSSLAPLVKLNTSCVSSPDFSPVTPPDTPSLSLDPQKDSSHIQHAVKVGQSYLFSKPPDP
TCEPPHFNIQSLVYRGGAAPLVSSPSSSTSIKSTSTVASNSMHTPREYENMENSIQPSHN
PSDIKMIKCEPINTAYISPKGGQSIGAAGFAAPGRVNQTLHTHGGHTASLYPHIHTLNTN
PQSMFSSGNKQPLMMSALSVTHRGGNLTSPPNHDLHTQGSNHNPHAASLVKGIKTGDYEG
SFSPLTPTETPSTNSSCAEATFTSNIIKTTFVTSQIVQEYPNKSDSSLVPDSATDSAPET
DQHMDPPKSCDTSKNNDLSCITDDESGDDLTIDEQSDGNQEVINRNTPLEEKQKKTLENE
DNDVCVRMEWPKTKKQLARKSQVVVKSSSGNQETSEVFNSCSFHDVNFNQQVFSFCCGTY
REIYVEQ
NT seq 3804 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaggaaatgaaaatgaaattcgtgttttgcgccttaaaagccctgcaggagcc
gaagctgcaatttataaatggccattgccaaaatatgaaactcgtgacggggcatttgaa
atcattgacacaatcaggtgggtttgcaaagattatcctgatctagagatggcaatggag
aagcatatactggcagattatgacacaaaaaactttgaaagcatgaaggaattatgcaac
aaatacaatagagccattgattctattttacaattgtggcaaggtacaagtaaatcagcg
ctgcttcaaactcaaccttcaactggcttgttgaaacacatcatgcaacaggtttacaac
catagtgtgttggagccggagaagttaaaccaatatgaaccattctcaccagaagtttac
ggtgaaacttcatttgatctcatatcacagatgttatgcgagttgaaattaaaggatgat
gatgtttttcttgatcttggaagcggagttggtcaggtggtgttacaagtagcagctgca
tcaccttgtaaactatgtctgggcattgagaaggcacccttgcctgggaagtattcacag
aacatggacaaggagtttcgtaagtggatgcgttggtatggtaagaaatatcggccgtac
aaacttgagacaggagattttctagaagaagaatggaaagatagaattgcatctgcaact
gttatattcgttaacaattacgccttcggaccagaagttgaccatcagttaaaggaaagg
tttgcaaacctaaaggaaggaagcaagattgtttcatcaaaggcatttgcacaagtcaac
tttcgaataacagatcgtaatttaacagatattggaactattttgagggtttctgtttta
tctcctttaagaggttcagtgtcatggacgcctaaccctgtcacatactatctgcaggtg
gttgatcgtacaatgcttgaaagatattttcttgcacaaactgacccaaaactacgtgag
gagcttgacatggaacacagaagatctaaagataatagtccagcacttagcatgtatcga
agcttgggtaaggaaaatgcaaaaccagtgtcagatcatatcactgagaaagatgtaaaa
gattcaaagaaatcaaacaattttaaaaagtcaagtatctcaccaaacaacacaaaaaag
catcaacgtattctaagtacaagtgacagtgatgcgcaagcagattcggattttggagaa
gctggcatcactgtgggaagtttagcgagtgattcctcggatgactttgctcctccaatt
aagaagaagggtttgggaggacacaaacgaagccggagcaaaagtttcttgaagacaaac
aagatgcgagtaaagccggaaaaaaatgtgaaggttgaagaaatatcggagagtgatcat
cgtagtaaacgtgcaaggagaagtggtagaagacctgcaacaaagtgtgtacggagctcg
ctttctactcccacttctactggcttagataatgcaaaacttatgaaacccatcaataag
agggctatggataatcacaatgccatccaacttctacatgaggtgactgtgggcagtgat
gtgagagatccaggtgattatgtaaacatgtcactgttgagcaaaccaatcattaccacg
ggttcatctcatgcttcttcaaacctcaaagataaacaactgtatgcactcgattttatg
tttgagcgatggaaaatgagagttttgcgattgatgtgtgactctgttggagatgtgttt
agtgagaggctacaaacacaatacactgtggagaccaaaaaaaatgaacatctgaaaatg
ttgaataagatgttttgtgcagatgtggagaggttaaaggaacgaacattgatgcttatt
caaactcgattgaatgacttgcaagttgagttcaaatcaccgaccacattacatgcaaga
aatggagataatcaccacgataccattcaacatttacaacaactacatttccatatcagt
aaaaacatcacgaatgacacagcaaagtcatccaatcagagcctttcaaaccaccagcaa
ctgcagaatgttttacatgatgctttgttatatttggaacaaagtgaaaaccctaatatg
gagtatatgagacacggaaacctacattattcaaattctgctaataatgaaaagttgttg
ggtccgatgcatggcgctcccgcctccacataccgaccactgggtggcctaccagtacag
atagaagcgagtacaggccaccaggcttcaaattctccacaatctcccaaagaaaccggc
caaacatcaaactcaaaaaggaaacctcatatacatcgtcgaacggaactacctgctgaa
gcaatgcagattgtgcaacaagtgctagataactacagagagggcagacaatgttcattg
gaaggcaaccagaagaaattgttaaaacataaaacattggacccaaaacacaattcaatt
cattctagtcttgcccctcttgttaagttgaacacatcatgcgttagtagtcccgatttc
tcacctgtcacaccgccggacactccatcattgtcattggatccgcaaaaggattcatct
cacatacaacatgcagtcaaagttggacaaagttatttattttccaaacctccagatcca
acatgtgaaccccctcactttaatatacagagtttggtttacagaggtggtgccgctcca
ctggtttcttcaccttcatcttctacttcaataaaatccacaagcactgtagcaagcaac
tctatgcacactccacgtgaatatgaaaacatggaaaactcgattcaaccttcccacaat
ccctctgatattaagatgatcaaatgtgagccaataaacacagcatatatttcccctaaa
ggtggacaaagtattggagctgccggatttgctgcgccgggaagagttaaccaaacactg
cacacacatggtggccatacagcttcattatatccccacatacatacgttaaacacaaat
ccacaatcaatgttcagtagtggcaataaacaaccattgatgatgtcagcattatcagtc
acgcatcgaggaggaaatctaacttccccaccaaaccatgatcttcatacacagggaagc
aaccacaatccacatgctgcttcacttgtaaagggaatcaaaacaggtgattatgaagga
agtttctccccactcacacccaccgagactccatcaaccaactcatcatgtgctgaagca
acttttacttccaatattattaaaactacctttgtaacatcgcaaattgtacaagaatac
ccaaacaaatctgattcatcattagttcccgattctgccacagattccgccccagagaca
gatcagcacatggatccaccaaaatcatgtgataccagcaaaaataatgatttatcttgt
atcacggatgatgaaagcggtgatgacctcacaatagatgaacaatcagatggtaatcag
gaagtgataaatagaaatactccattagaagaaaaacaaaagaaaactttagaaaatgag
gataatgatgtttgtgtaaggatggagtggccaaaaactaaaaaacaacttgcaagaaaa
agtcaagttgttgtcaaaagtagttcaggtaatcaagaaacaagtgaggtttttaattca
tgttcgtttcatgatgtgaattttaaccaacaagtgttctctttctgttgtggaacatac
agagagatttatgttgaacaatag

DBGET integrated database retrieval system