KEGG   Ciona intestinalis (sea squirt): 100178412Help
Entry
100178412         CDS       T01056                                 

Definition
group XV phospholipase A2-like
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Glycerophospholipid metabolism
Lysosome
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:cin00564]
Cellular Processes; Transport and catabolism; Lysosome [PATH:cin04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 429 aa AA seqDB search
MYARSCFSVVLIVAMCCILLPQSQQTQTFTKPQNTGQKTSCVSPDKYNRKPIVMIPGVLG
SQLEAKIDKPDVVSILCSRKSDWFSLWLNLDGLLPFLVDCWVDNIKMLYNNETKQVRNNY
GVQTRVPRFGSTYAFEYLDKDKYAIGSLYFAPLVDHMTCNLGYTKQKDLYGAPFDWRLSP
LQHKVYFKKLGTLIETAYYNNNNTKVVVIGHSMGNMFMYYYLKQKTQAWKDKFIDSFVSI
SSPYFGSVKSLKALLSGETEGHDWVLPKLKLRNVVRTAPAFDFVLPNPDLWPHNKKTIVV
TIKQNFTVFQYKDLFKRIGCEGCWDLWKQNGKVLGKFTPPKVPVYCVYSSLVPTPEVLMY
DEDLFPDQSPSMVDGDGDGTVNRFSGSACLKWKTMQTQPVYDVPMPGNKHVQILGNETLH
NYLNHVVLR
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgtatgcacgaagttgtttcagtgttgtactcatagttgctatgtgttgcattttatta
cctcagtctcaacagacacaaacatttaccaaacctcaaaatactggccagaagacaagt
tgcgtttcaccagacaaatataatcgcaagccaatagtaatgatacctggagttttgggt
tcacagctagaagcaaagatagacaaaccagatgtggtttccattctttgttcaaggaaa
tcggactggtttagtttgtggctcaatcttgatggacttttgccgttcctggtggactgc
tgggttgataacataaagatgttgtacaacaatgaaacaaagcaagtcagaaacaactat
ggtgtacagaccagagttcctcggtttggatctacttatgcatttgaatatttagacaag
gataaatacgcaataggtagtttatattttgcgcccctcgttgaccatatgacctgtaat
ctgggatatacgaagcaaaaagatctctatggtgctccattcgactggcgcttgtcacca
ttgcagcataaagtttacttcaaaaagttgggcacacttatagagactgcttactacaac
aacaacaacaccaaagtagtggtgattgggcatagtatgggcaatatgttcatgtattat
tatttgaagcaaaagacgcaagcctggaaagacaaattcattgattcatttgtgtccatt
tcatccccttattttggttcagtcaaatctctaaaagcactgctttcaggtgaaacagag
gggcatgactgggttcttcccaaactgaagcttcgaaatgtggtacgaactgccccagct
tttgactttgttcttcctaacccagacctgtggccacataacaaaaaaaccatagtagtg
accatcaaacagaacttcactgtttttcaatacaaagatttatttaagagaattggttgt
gaaggttgctgggatctttggaaacaaaatgggaaggttcttggtaaattcacaccaccc
aaagttcctgtttactgcgtgtattcaagcttggttcccacaccagaggtattgatgtat
gatgaagatttatttcccgaccaatctccatctatggttgatggcgatggtgatggtaca
gtgaacagattcagtggttcagcttgtcttaagtggaaaacaatgcaaacgcaacctgta
tatgatgtaccaatgcctggtaacaaacacgttcaaattttgggcaacgaaaccttacac
aattatctaaatcatgttgtactgaggtaa

DBGET integrated database retrieval system