KEGG   Ciona intestinalis (sea squirt): 100178428Help
Entry
100178428         CDS       T01056                                 

Gene name
hexb
Definition
(RefSeq) beta-hexosaminidase subunit alpha
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
cin00511  Other glycan degradation
cin00520  Amino sugar and nucleotide sugar metabolism
cin00531  Glycosaminoglycan degradation
cin00603  Glycosphingolipid biosynthesis - globo and isoglobo series
cin00604  Glycosphingolipid biosynthesis - ganglio series
cin01100  Metabolic pathways
cin04142  Lysosome
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    100178428 (hexb)
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    100178428 (hexb)
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    100178428 (hexb)
   00604 Glycosphingolipid biosynthesis - ganglio series
    100178428 (hexb)
   00511 Other glycan degradation
    100178428 (hexb)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100178428 (hexb)
Enzymes [BR:cin01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     100178428 (hexb)
Chaperones and folding catalysts [BR:cin03110]
 Intramolecular chaperones
  Others
   100178428 (hexb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_20 Glycohydro_20b2 Glyco_hydro_20b
Motif
Other DBs
NCBI-GeneID: 100178428
NCBI-ProteinID: XP_002126592
Ensembl: ENSCING00000004311
UniProt: F6SHN0
Position
4
AA seq 538 aa AA seqDB search
MLRQLFFVTSIAVVALANSQRKLSLDFPTPLLGNTSPGSVWPQPESHVSTAETFPVAVES
FMFTYASKSYKCDLVYEAFKRYGAIIINSAGDQKLRFRPLTTPMLTGLEVNLMAPCEDYP
SLDMDESYALDINSMAVATLTAKSVWGILRGMESFSQLLWESDSGQIVANKTNIIDKPRY
AHRGILLDTSRHYQPVNVILENIDGMAYNKINVFHWHIVDDQSFPYVSTVYPDLSAKGAY
NPITHIYTIEDVAEVIEYARLRGIRVVPEFDTPGHTTSMGKGQPGLLTECYTGSNPNGNY
GPINPTVNTTYTFIQNLFTEVKSSFKDAYIHLGGDEVSFSCWQSNPAINNWMKSHNMTGD
YKKLEQVYIQQVLDISAAIGYSYIVWQEVVDNGVKVKADTVVEVWINNHPDNELAKVTAL
GYRALLAAPWYLDYISTGEDWKRYYSYEPSNFNGTAEQKKLLIGGEACLWGEYVDGSNVT
PRLWPRASAVAERLWSPETVNDVDAATPRLHQHRCRMVQRGIPAEPLHPGYCKHEWRN
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgttacgtcagttattttttgttacttctatcgctgtggtcgctctagcgaattctcag
cgaaagttatcacttgacttcccaactcctttgcttggcaacacaagtcctggtagtgtg
tggcctcaacctgagtcccatgtatctacagcagagacattcccagttgcagttgaatcg
ttcatgtttacttatgcatcaaagtcctataaatgtgacttggtgtatgaagcatttaaa
cgatatggtgccatcattattaacagtgctggagaccaaaagctcagattcaggccactg
accacaccaatgctcactggtttggaagttaacttgatggctccatgtgaagattatcct
tccttagacatggatgaatcatatgcccttgatattaacagcatggctgttgcaacatta
acagcaaaatcagtttggggaatattaagaggaatggaatcattttcgcaacttttgtgg
gagtccgattcaggacagatagttgcaaacaagacaaacataatcgacaaaccaagatac
gcccatcgtggaatattactcgatacttcaagacattaccaacctgttaatgtgatactt
gaaaatattgatggcatggcttataacaagatcaatgtatttcattggcatattgtggat
gaccagtcattcccatacgtcagtactgtgtatcctgatcttagtgcaaagggagcatac
aacccaatcacacatatctacacaatcgaagatgtggcagaagtaattgaatatgctcgt
ttacgaggcattcgtgttgtgcctgagtttgacacaccaggacacacaacatctatgggc
aaaggacaaccaggacttctaacagaatgctacacaggaagcaacccaaatggaaactat
ggtcccatcaaccctacagtgaacaccacatatactttcatacagaacttattcactgaa
gtaaaatcatcatttaaagatgcttacattcatcttggtggtgatgaagtcagctttagt
tgctggcaatccaaccctgccattaacaactggatgaagtcacacaacatgacaggggat
tataagaagttggagcaagtctacatacaacaagtgcttgatatcagtgctgccattggt
tacagctacattgtgtggcaggaagtggtggataatggtgtcaaggtaaaagctgacaca
gtagttgaggtgtggataaacaaccatcctgataatgagcttgctaaagtaacagcattg
ggatacagagcccttcttgctgctccatggtatcttgattacatatctactggggaagat
tggaagagatattattcatatgaaccatctaattttaatgggactgctgaacaaaagaaa
ttgttgattggcggtgaagcttgtttatggggtgaatatgtggatgggtcaaatgttact
ccaagattatggccacgagcaagtgcagtagctgagagattgtggagtccggagacggtg
aatgatgtggatgctgctactccaagacttcaccaacatcgatgtaggatggttcagagg
ggaatacccgctgaaccccttcacccaggctactgcaagcacgagtggagaaactaa

DBGET integrated database retrieval system