KEGG   Ciona intestinalis (sea squirt): 100178479Help
Entry
100178479         CDS       T01056                                 

Definition
(RefSeq) serine/threonine-protein kinase mTOR-like
  KO
K07203  
FKBP12-rapamycin complex-associated protein
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:cin00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    100178479
Protein kinases [BR:cin01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   100178479
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
9
AA seq 2487 aa AA seqDB search
MAESVQAFVQGLKSRNEDTRLSIATALQHYINTEVQELSSEQNIEFMSELNSNIYDMLSS
SDIHEKKGGLLGIVSQIDVDGSDGQLLKFYNLLRNLLPSPDIGVMEIAAQVMGRMAASSG
YRTEHIEFQVQRSVEWLGTEKNDPKRHAAVLVLREMAVSSSTIFYQQIQSFFDGIFHVIH
DSKQSIRECAIEALRAALSLVVQRETKDSKYRPAWYEACYDEATSICDPVTFEKPSIIRD
DRVHSSLLILIELLRVCTTDELFLSGDSAPSSIYSPKHSNLSSSSEKSRLFRSNKSTSFK
LSTFLMSSYQGSSVQPPSALSSSTSVSGMLLKSSLCCKLLSDKFEHMCQFVLTFRSSRSV
LVQHSVLSLLPRLALFDPEKFTKSSLSEAMTFLFSCLKKERDRSAAFLATGLMSVAVKDA
IEPYLTKLFEFIKQYLPTKEPATKRHRNYVPESSVFGCISMLAKSAPAITLHYIRDELLQ
SMFNVGLNGAAMQSLHELSSIASLYQSIQEGVLNILSSVLLPNQHAAGDNTSEATEMATI
ILALRTLALFPFPGNEAKRSKILPQPFMDFCEECSTAKYLCHENREVRLHAVATVVALMR
PSIPRPCTSSHQTVIYPVLSPKLSKIIGSILNLAIADSDKQVRMHVLNLLDDRFDCYLIL
SENLNLLFVALHDEAFEVQELAIQTIGRLSELNPAYVMPMLRKTHIQLVAELEHSGIGRN
KLQASRLIGHLARNAPNVMKAYVVPTIKTLLMKLSDEEQTVAVSVGMMRTIGDLAEVGGK
DVSVVTDHLFPIILSMLQEMSCFTKREVALVTLGKIVESTGYVVEPYFKCPMLIDVLLGF
LKTEPSLAFRKEVMKVLGLIGTLDPFKHKMNQGSTEDVSVGANERRVKKDTDFNVNEMLV
SIGTTSEDFYPAVAITTLMRVLRDPLLSSHHKDVIQAVNHMFESLNVKCVPYLPEIIPTY
LSTIQTCDPSIREFLFKNLGLIISTVKQHARGFMDRIFVVIKEHWGVGSEMQSILLSLSE
KIASALSSEFKLYLPQIIPHALRIFLYDDSPGKTVTLDLLHALQVFGVNIDDYSHLLLPP
MMQLLRATTTPINIKSAILETLCTLCECIDLCEHMSLVVHPLANVIDTIPDLQSLAVRTL
CSAIRQFGSRFSVFVQMVDQLMLKHKISSSLYESLVSQITKGILRQDTDAFLWSGIQKVE
DTSVQSSDVSLTKKTRIHTSNLQKAWTVTRRVSKDDWLEWLRHLSVELLKESPSLALKAC
SAFAKTYTPLARHLFNASFLSCWSELDEGQQNELITCIQMALAAPDVPPEVTHTLLNLAE
FMEHTDKGPLPMSDDNGVALLGETASRCRAFAKALHYKELEFSKNKSSAVIGDLININSK
LGQPEAADGALQCYINTIQKPNQQHNINVEWYERLHKWVEAKNAYHTKLRVPLSEVDCPD
EKMREERMSEHKIGYMRCLEALGEWDNLHSYAEEQWSTCMVGDAKKRMARLAAAAAWGLG
KWNSMDEYTCMIPREHYDGTLYRAVIAIHQGHFPQAQECISEAREILDSELTALAGESHS
RAYPALVNCQLLAELEEVIHYKLMPDRRAVIRQAWWDRLQGCQRKLEDWQRIIQVRSLVV
SPQEDMRTLLKFSSLCMKTGREVLAHKTLVKLLNMDPRKEPNKPLPTTYPYVSFAYIKHI
WKQNKKEEALTRMHKFVASIQNVPSTLSDADQRSELNHLLSRCFLKLGAWHQDMKGLSDQ
NISQVINFHKLSTEHDRSWYKAWHSWAVVNFECVLFYKNKLDIATESQLPREIPDYLEKG
LSKDDSSEDSDLSCSDPELNQPIQLKNIAQPDFSSTILTYAIPSVQGFFHSIALSHGNSL
QDTLRVLTLWFEYGHHHKLHDVIVEGIKTIKIENWLQVIPQLIARIDSPKSLVSNINHLL
LTDIGKHHPQALIYPLAVASKSAIPMRNIAANKILNKMCDHSNTLVKQAILVSEELIRVA
ILWHELWHEGLEEASRLYFGERDVRSMLATLQPLHALLERGPQTLKEISFNQAYGRDLQE
AQDWCRKFTQSSNIKDLNQAWDLYYHVFRRISKQLPQLTTIELQYVSPKLMVCKDLELAV
PGTYNALKPIVCIRSIQHTLQVITSKQRPRKLSIKGSNGRDYTFLLKGHEDLRQDERVMQ
LFGLVNTLLSMDQASSRKNLGIQRFSVVPLSTNSGLIGWVPNCDTLHALIRDYRDKKKIL
LNIEHRIMLRMAPDYDHLSLMQKVEVFEHAINNTAGDDLARLIWLKSPTSEAWFDRRTNY
TRSLAVMSMVGHVLGLGDRHPSNLMLDRISGKVLHIDFGDCFEVAMAREKFPEKIPFRLT
RMLTNAMEVTGIEGNYKHTCRMVMNVLRQHKESVMAVLEAFVYDPLLNWRLVESSEHGRI
MESGSISDALGVGHTGIAQTPGETGTARPEVLNKKALVIVNRVRDKLTGCDFSAVSIDVP
TQVDLLIKQATSHENLCQCYIGWCPFW
NT seq 7464 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaagcgttcaagcatttgttcaaggcctcaaaagtcggaatgaagacacacga
ttgtcaatagctactgcactgcagcattatatcaacacagaggtacaagagctatccagc
gaacaaaacattgaatttatgagtgaattaaactctaatatatatgacatgttgtccagc
tctgatattcatgaaaaaaaaggaggtttacttggtattgttagtcagattgatgtggat
ggaagtgacggacaacttttgaagttctacaacttgttgaggaacctattgccttcacct
gatattggggtgatggagattgctgctcaagtaatgggaagaatggcggcatccagtggt
tatagaaccgaacatattgaatttcaagtacaaagatctgttgaatggttggggactgaa
aaaaatgacccgaagagacatgctgctgtccttgtattgcgagaaatggctgtcagttca
tcaactattttctatcaacaaatccagtctttttttgatggaattttccacgtcattcat
gactcaaagcaatcaatacgggaatgtgctattgaagctttacgagctgcattgtcgctt
gttgttcaacgagagacaaaagattcaaaatataggccagcatggtatgaggcttgttat
gatgaagcaacttcaatatgcgatccagttacatttgaaaaaccatctattattcgtgat
gaccgtgtacattcatcattacttatattaatcgagctactacgtgtgtgtactactgac
gagttatttttatctggagattctgcaccaagttcaatatattcaccaaaacattcaaat
ttaagttcaagttcggaaaaaagccgtttattccgaagcaacaaaagcacttcgttcaag
ttatcaacgtttttaatgtcttcatatcaaggaagttctgtccaaccaccctctgcactg
tcgagcagcacttccgtgtcgggaatgttgttgaaaagttcattgtgctgtaaactgctt
tcagataaatttgaacatatgtgtcagttcgttcttacattccggtcttcaagaagtgtc
ttagttcaacattctgttctctctcttttaccgcgtcttgctttgtttgatcctgagaaa
ttcacaaaatcttcgttatcagaagctatgacttttctgttctcttgtttaaaaaaggag
cgagatcgttcggctgcttttcttgccacaggcttaatgtcggttgcagtaaaagatgca
attgaaccttacctgactaagttgtttgaattcataaaacaatatctgccaacaaaagaa
cccgctacaaagcggcatagaaactatgtacctgaatcctcagtgtttggctgcatatca
atgctagccaagtctgctccagcaataactctgcattatattagagatgaattattacaa
tctatgttcaatgttgggctaaatggtgctgctatgcaatctctgcacgaactaagcagc
atagcaagtttatatcaatccatacaagaaggtgtgctcaatatactttcaagtgttctg
cttccaaatcaacatgctgctggtgataatacttcagaagcaacagaaatggcgaccata
attcttgcgttgagaactctggcattatttcctttccctggcaacgaagcaaaacgttca
aaaattctcccccaaccattcatggacttctgtgaagaatgttccacggctaaatacttg
tgccacgaaaatcgtgaagtgaggttacatgctgtggctacagttgttgcacttatgcga
ccttctataccaaggccttgtacatctagtcaccaaacagtgatttaccctgtgctgtca
ccaaagttgtcaaaaattattggaagcattttgaacttggcaattgctgattcagacaaa
caagttcgaatgcacgttcttaatctgctggatgatcggtttgactgctaccttatcctg
tctgagaatctaaacctgttatttgttgccctgcatgatgaagcattcgaggttcaagaa
ttagcaattcaaactattggtagattatctgagttgaacccagcttatgtgatgcctatg
ctacgaaaaactcatatacagcttgtggctgaacttgaacacagtgggattggaagaaat
aaattacaagcttcacgtttaattggtcatcttgcacgaaatgcaccgaatgtaatgaag
gcttatgttgtaccaactataaagaccttgttaatgaaactaagtgatgaagaacaaaca
gttgctgtgtctgttggtatgatgagaaccatcggtgacctcgctgaggttggaggaaag
gacgtgagcgttgtaacggaccatcttttccccatcatattatcaatgctgcaggaaatg
tcttgttttacaaagagagaggttgccctcgtgacacttggtaagatagtggaaagcact
ggatatgtggtggaaccttattttaaatgtcccatgttaattgatgtcttactggggttc
cttaaaactgaaccaagcttggcatttcgaaaagaagttatgaaagtgcttggtttgatt
ggaacattagatccgttcaaacataaaatgaaccaaggatcaactgaagatgtttctgtt
ggtgccaacgaacgaagagtaaagaaagataccgatttcaatgtaaatgaaatgctagtt
tcaattggaacaacatcagaagatttttatcctgctgttgccataacaactctcatgcgt
gtattacgtgatccattgttatcctcacatcataaagatgtcatacaagctgtcaatcac
atgtttgaatcattaaacgtgaagtgtgtaccttatctaccagagataataccaacatat
ttatcaactattcaaacttgtgatccaagcataagagagtttttgttcaagaacttgggt
cttatcatcagcacagtgaaacagcacgctcgaggattcatggatcggatatttgttgtt
attaaggagcactggggggtggggagtgagatgcagagcatcctcctctctctctcggag
aaaatagcatccgctctctcctctgagtttaaactttatcttccccaaataattcctcat
gccctgcggatattcctatatgatgatagtccgggaaaaactgttacacttgaccttctc
catgctttacaagtgtttggggtaaatatagatgattacagtcacctgttgcttccacca
atgatgcaactactacgtgctactactacacctattaatataaaaagtgcaatccttgaa
acattatgtacgttgtgcgaatgcattgacttgtgtgaacatatgtcattggtggttcat
ccacttgctaatgtaattgatacaattcctgatctacagtcattagctgtccgtacttta
tgctctgctatccgacagtttggatcaaggttctctgtatttgtacaaatggttgaccag
cttatgttgaaacacaaaatctcaagttcactttatgaaagtcttgtatctcaaattact
aagggtatattgcggcaagatacagatgcattcttatggtcgggcattcaaaaagttgaa
gacacttctgtacaatcatctgatgtatcgcttactaagaaaactcgcattcatacaagt
aacttgcaaaaggcatggacagttacacggcgtgtctcgaaagatgattggttagaatgg
ttgcgtcatttaagtgttgaattattaaaagaatctccatctcttgcattaaaagcttgc
tctgcgttcgccaagacttacactccattagcaagacatttattcaatgcatcattcctg
tcatgttggagtgaactggatgaagggcaacagaatgagttgatcacttgcatacagatg
gcacttgctgcacccgacgtaccaccggaagtcactcacactttacttaaccttgcagag
tttatggaacacacagataagggcccactacccatgtctgatgacaatggtgtagcttta
cttggtgaaacagcatcaagatgtagagcgtttgccaaagctttacattataaggaactg
gagttcagcaaaaataaatcaagtgctgtcattggtgatctgatcaacatcaacagtaaa
cttggtcaaccagaagcagcagatggagcacttcaatgttacatcaacaccatacagaaa
ccaaaccaacagcataatatcaacgttgaatggtatgagagattacataaatgggttgaa
gcaaagaacgcctaccacaccaagttacgagttccgttatctgaagttgattgtcccgat
gagaaaatgagagaagaaagaatgagcgaacataagattggatacatgaggtgtttggaa
gcattaggggaatgggacaacttgcatagttatgcagaagagcaatggtccacatgtatg
gtaggtgatgctaagaaacgaatggctcgcttggctgcagctgctgcatggggacttgga
aaatggaacagtatggatgaatacacatgcatgataccacgtgagcattatgatgggacc
ttgtatcgagctgtcatcgcaatacaccaaggacatttcccacaagcacaagagtgcatc
agtgaagcacgtgagatactcgacagtgagttgacggctctagcgggtgaatctcacagc
agagcttaccctgcgttggttaactgtcaactcctcgctgaattggaagaagttatacat
tacaagttgatgccggatagacgtgccgtgatcagacaagcatggtgggacagactacag
ggttgccagaggaaacttgaagattggcagcgaataattcaagttcgatctctggttgtt
tcaccacaggaagacatgagaactttgctcaagttttcaagtctttgcatgaaaactggt
agagaggtgctagctcacaagactctggtcaaacttcttaacatggatccaaggaaagag
cccaacaagccattacccacaacttacccttatgtatcatttgcttatattaagcacatt
tggaaacagaataagaaggaagaagcattaaccagaatgcataagtttgttgctagcatt
caaaacgtgccttccacattatctgatgctgatcaaagaagtgaattaaaccatctatta
tcaaggtgtttcctgaaattgggtgcatggcatcaggacatgaaaggattgagcgaccaa
aatatttctcaagtcatcaactttcataaactttctacagagcatgaccgcagttggtat
aaggcatggcactcatgggcagttgtaaactttgagtgcgttttgttttataaaaacaaa
cttgacattgccactgaaagtcaactaccccgggaaataccagattatttggaaaaaggt
ttaagtaaggacgatagcagtgaggattctgacttgagttgttctgatcctgaacttaat
caacctatccagttgaaaaatatcgcgcaaccagatttcagctccacaattctcacatac
gcgattccatcagttcaaggattctttcattcaatcgctttatcccatggcaactctctg
caagacacactcagagtattaacattatggtttgaatatggccaccaccataagttacac
gatgtcatcgtggaaggaattaaaacaatcaagatagaaaactggctgcaggtgatccca
caattaattgcaagaatagattccccaaaatctttagtttcaaatataaaccatctcctg
ttaactgatattggaaagcatcatccacaggccttaatctacccactggctgttgcatct
aaatcagccatccctatgagaaacattgctgccaataaaatattaaataaaatgtgtgat
cattcaaatacacttgtcaagcaagcaatattggtatctgaagaattgataagagttgca
atattatggcacgagttatggcatgaagggttagaagaagcatcaagactttactttggg
gagcgtgacgtaagatcaatgctcgccactcttcaaccactgcatgctttgttggaacga
gggccacaaactttgaaggagatcagtttcaatcaggcttatggtcgtgacctgcaagaa
gctcaagactggtgtcggaaatttacgcagtcgagtaatattaaagatcttaatcaagca
tgggatctttattatcatgtgtttagaaggatatctaaacaattaccacaactcaccacc
atagagttacaatacgtctcacccaagttaatggtgtgcaaagatctggagttggccgta
cctggaacttataatgcattgaaaccaattgtgtgtataaggtccatacaacatacatta
caagtgattacctcaaaacaaagaccaagaaaactgtccattaaaggtagtaatggcaga
gattacacgttcctgttgaaaggtcatgaggacttaagacaagatgagagagttatgcag
ttgtttgggttggtgaatactttgctgtcaatggaccaagcttctagcaggaaaaacctt
ggaatacaaagattttcggttgttccattatctactaactccggtttgattggttgggtt
ccaaactgtgacacgttacatgcactcattcgtgattatcgagataaaaagaaaattctt
ctaaacatcgaacacaggatcatgctacggatggcaccagattatgatcatttatcattg
atgcaaaaagtagaggtgtttgaacatgcgataaacaacactgctggtgatgatttggct
cggttaatctggttaaaaagtccaacgtcagaagcttggtttgatagaagaacgaactat
acgcgatcattagctgtaatgtcgatggtaggacatgtgttggggttgggggacagacat
ccaagcaacttaatgctggatagaataagtggaaaagttcttcatattgattttggtgat
tgcttcgaggttgcaatggctcgtgaaaagtttcccgaaaaaattccgttccgcttaact
cgcatgctgactaatgctatggaggtgacgggaattgaaggaaattacaaacatacttgt
cgaatggtaatgaatgtattaagacaacacaaagaaagtgtgatggccgtcttggaagct
tttgtttacgatccattacttaactggagacttgttgagagttctgaacatggtcgaata
atggagagtggttcaatatccgatgcattgggtgttggtcatactggtattgcgcaaaca
ccaggtgaaacaggaactgccagacctgaggttctcaacaaaaaagcgcttgttattgtt
aatagagttcgagataaactgacaggttgtgatttcagtgctgtttcaatagatgtaccc
acacaagtagatttgttaattaaacaagcaacttctcatgaaaacttatgccagtgttat
atcggatggtgtcctttctggtga

DBGET integrated database retrieval system