KEGG   Ciona intestinalis (sea squirt): 100178587Help
Entry
100178587         CDS       T01056                                 

Definition
serine/threonine-protein phosphatase PP1-beta-like
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:cin00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    100178587
Enzymes [BR:cin01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100178587
Protein phosphatases and associated proteins [BR:cin01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     100178587
Transcription machinery [BR:cin03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     100178587
Spliceosome [BR:cin03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100178587
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 330 aa AA seqDB search
MSDPDKLNVDKIIAMLLEVRGSRPGKNVQLSENDIRGLCLKSREIFLSQPILLELEAPLK
ICGDVHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETIALLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPLAAIIDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKEVSGWGENDRGVSFTFGPEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPSD
KKKYPYGGMVSGRPVTPPRAGAAKSKPGKK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatccagacaaattaaatgttgataaaattattgccatgttgttagaggtgcga
ggttctcggccggggaaaaacgtccaactttcggagaacgacattcgtggtctttgttta
aagtcaagggagatatttctaagtcaacctattctacttgaattagaagctcccctaaaa
atatgtggtgacgtccacgggcaatattatgatttgttgaggttgtttgaatacggaggt
tttccaccggagtcgaattatcttttcctcggagattatgtcgatcgtggaaaacaatcc
ttggaaacaatagctctgttgctcgcttacaaaataaaatatccggagaatttcttcctt
ttacgaggcaaccatgaatgtgcgagcatcaacagaatatatggtttctatgatgaatgt
aaacgaaggtacaacatcaagttgtggaaaacattcaccgattgtttcaactgtcttcca
ctggctgcaataattgatgagaagatattctgctgtcatggagggttatcccctgacctt
caatcaatggaacaaatccgtcgtataatgcgtcccacggatgttcccgaccaaggcctc
ttgtgtgacctcttgtggtcagatcctgacaaggaagtatcaggttggggtgagaacgac
aggggggtgagttttacattcggacccgaagttgttgcaaagtttcttcacaaacatgac
cttgacctcatatgtagggctcatcaggtagttgaggacggatacgaattcttcgcgaaa
cgtcaactcgtcactttgttctcggcccccaattattgcggggagttcgacaacgcaggg
gccatgatgagcgtggatgaaaccttgatgtgttcgttccagatattgaaaccatctgac
aagaagaagtatccatacggtggcatggtgtcaggtcgtcctgtgaccccgccacgagcc
ggagccgcgaaatctaaacctgggaaaaagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system