KEGG   Ciona intestinalis (sea squirt): 100178711Help
Entry
100178711         CDS       T01056                                 

Definition
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1-like
Orthology
K01116  
phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100178711
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    100178711
Enzymes [BR:cin01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100178711
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 1286 aa AA seqDB search
MPVQYPNGPTVVHGIVDPKFQNESELQGVLRRLVMGNMMKKIVVRKGKLEERTFQVNLET
RQVVWQRAGVLEGSIDISEIKEIRHGKVSRDFDKLADVSRKLDSAVCFTILYGNEFNLKI
LSIVAKQQSEREVWIRGLSYLVIDTLKSHYTLQVERFLRKEFNQICRRNLKKNNTDGEEP
RITLRTVKAWLPNVNAKALPTSQLKEMFQEVDIRKRGEIGFEQFVQFYYNLMFSCQKSIL
TFVQHYSSDRLRFTAHDFQKFLIQEQKEDWANDINAVKTFMIEYLGDSSRANDSVYFDNK
EMMAYLFSKENSLWNSKYNEIPDGMLDKPLSQYWISSSHNTYLTGDQFSSESSCEAYARA
LRMGCRCIELDCWDGPDGMPHIYHGLTLTSKIKFHDVLKTIREHAFVVSDLPVILSIENH
CKLPQQRHMATKFVDIFQDMLVRLSVSANEQTLPSPNQLRGKIIIKHKKLSDANRSTEVF
IERSTADLTMDISNSVKNGMMYFEDPTFKEWNLHYFVLTEDNKLVYTEERQTQPHDDTTS
EDGSIDESANNDRRGSSDTTELHYAEKWYHGQMGRDEADQLLRDYNGKDGSFMVRESATF
IGNCTLSFMYHGRVTHCRIHSQQNNGHTYFYLVHALLFDSLYSLVWHYQRYPLRNAKMNF
ELLLTEPVPQPNAHANKEWYHDSMTRTDAENVLMRIPRDGAFLVRKCRSDDPSVTSFAIS
FRADGKIKHCRIKQESRLFVIGNATFETLCDVISFYEKNPLYRKMKLKHPATKEQVQCLL
QEPNFYSEDHGAVGGSVAYVPPNFMSVTVKALYDYRAARDDELTFCKHAIISNVIKQDGG
WWRGDYGGKAGMWFPSNYVEEMESASKEPGSTILGDMQKGVIDLANSNIELLPSGRGHQK
HAFRICRSNGDQLHLATETKDDLVSWLNNLKEAIDKHDSQAKKWKDIEKHTRIAVELSDL
IVYCRPVQFNENGHCYEMSSFPESKAERYACRDKARIFINYNRKQFSRIYPKGSRVESSN
YNPMPFWNCGTQLAALNFQTGDRSMQLNEARFEMFNRCGYVLQPQFFENELYHPYNKGNI
QGVEPLIMNIQVIGARHLPKSGRGLACPFIEVEIIGCDYDDGKVKTPKKDDNGLNPTWDN
SSSTNNDSSFDFDILVPDTAFLRFTVYDQDMFGDPNFLAMASIPVPCVKSGLRSVPLKNT
YSEDIPLAALLVHLDVRSAKEEDDGLYDSIQRLRDQTKELQSKISSQQSYNPTDMMSYHQ
QLCETQKALFMQNEQRKERMIQRLRH
NT seq 3861 nt NT seq  +upstreamnt  +downstreamnt
atgccggtccaatatccaaatgggccaaccgtggtacatggaatcgtggacccaaagttt
caaaatgaatctgagttgcagggtgtcttgcggcgtctggtcatgggaaacatgatgaaa
aaaattgtggttcgaaaaggaaaattagaggaacgaacatttcaagttaatctggaaact
cgacaagttgtttggcagcgtgcaggagtgctagaagggtcaattgatattagtgagata
aaagaaatccggcatggcaaagtttcacgagatttcgacaaactcgcagatgtttctcgc
aagttggattctgcggtctgctttacaattctgtatggaaacgaatttaatctcaagatt
ttatcaatcgttgctaaacaacagagcgagcgtgaggtgtggatccggggtttgtcttat
cttgtaatcgatactttgaagtcacattacacacttcaagttgagaggttcctaagaaag
gaatttaaccaaatttgccgcagaaacttgaagaagaacaacactgatggtgaagaacca
agaatcacattaaggacggtgaaagcttggcttcctaatgttaacgccaaagctctgccc
acatcacagctaaaggaaatgtttcaggaagtagacataagaaaaagaggggaaattggt
tttgaacaattcgttcagttttactacaacctcatgttcagttgccagaaaagcatcctc
acttttgtgcagcattattcttcagacaggttacggttcactgcacacgattttcagaag
tttctgatccaagaacagaaagaagattgggcaaatgatataaacgcggtgaagaccttc
atgattgaatatcttggtgattccagtcgagcaaatgattcggtgtattttgataacaag
gagatgatggcttatctattctcgaaagaaaattctttatggaattcaaaatacaatgaa
atccctgatggaatgttggacaaaccattatctcaatattggatttcttcttcacataac
acatacttgactggtgatcagttcagtagtgaatcttcatgtgaagcgtatgcacgtgca
ttaaggatgggatgcagatgcattgagttggattgctgggatggtccagatggcatgcca
catatataccacgggctaaccctcacatccaagattaagtttcatgatgttttgaagaca
attcgtgaacatgcctttgtggtgtcagaccttcctgttatcctttctattgagaaccat
tgtaaattacctcagcagagacatatggcaactaagtttgttgacatatttcaagacatg
ttagttcgattatctgtgtctgcgaatgaacaaacccttccctcacccaaccaacttaga
ggaaagataattatcaagcataagaagttaagtgatgcaaacagatcgactgaagtattc
atagaacgaagtacagcagacctgacaatggatatcagcaactcagttaagaacggtatg
atgtattttgaagacccaacttttaaggaatggaaccttcattattttgtcctcacggaa
gataataagttggtttatacggaggaacgacaaacgcaacctcatgatgacacaacgtcc
gaggatggaagcatagatgagtcagcaaataatgatcgaaggggtagttctgacaccact
gagctccactatgcagagaagtggtatcatgggcagatggggagggatgaagctgatcaa
ttacttcgtgattataatgggaaagatggttcatttatggtgagggaaagtgcaaccttc
attggaaactgtacattatctttcatgtaccacgggcgtgtcacacactgcagaattcac
tcgcagcaaaacaacgggcatacatacttctaccttgttcatgctctcttgtttgatagt
ttatacagtttagtatggcactaccagcgctacccgctcagaaacgccaagatgaatttt
gaacttttactgactgaacctgttccgcaacccaatgcacatgctaataaagaatggtac
catgacagcatgacacgaacggatgctgagaatgttttgatgagaattccccgtgacgga
gctttccttgtgaggaagtgtcgatctgatgacccttcagtgacctctttcgctatttct
ttcagagctgatggaaagataaaacattgtcgaataaaacaggagtctcgcttgtttgtg
atcggaaacgccacatttgaaactttgtgcgacgttatttcattctatgagaaaaatcct
ctttatagaaaaatgaaattgaaacacccggcaactaaggaacaagtgcagtgtctgtta
caggagcccaacttctacagtgaagaccacggagctgtaggtggaagtgtggcttacgta
ccccccaactttatgtcagtaacagtgaaagctttgtacgactaccgagccgcacgtgat
gatgaacttactttctgtaaacacgccatcatatctaacgttattaaacaagatggcgga
tggtggcgaggggattatgggggaaaagcaggaatgtggttcccaagtaattatgtggaa
gaaatggaatctgctagcaaagaacctgggagtactatacttggagacatgcagaaagga
gtcattgatcttgctaactctaatatagagctgcttccatctggaaggggccaccagaaa
catgcgtttcgtatttgccggtctaacggggaccagcttcacttagcaactgaaactaaa
gatgatctcgtttcttggttgaataatttgaaagaagcgattgataaacatgattcgcag
gcaaagaaatggaaggatattgagaaacacacaaggattgctgttgagttgtcagatctg
attgtttattgtcgacctgtccaattcaatgaaaacggccattgttacgaaatgtcatcc
ttccctgaaagcaaagcagagcgatatgcatgtcgcgataaagcaagaatattcatcaat
tacaacagaaaacaattctcaagaatttatccgaagggatcacgagtagaatcatccaac
tacaacccaatgccattctggaattgtggaacccaacttgctgctcttaactttcaaact
ggagaccgttctatgcagttaaacgaggcaaggtttgagatgtttaacagatgtggatac
gttctacagcctcagttctttgagaatgaactttatcatccgtataataaaggaaatata
caaggagttgaacctcttataatgaacatacaggtaataggagctcgccatcttccaaaa
tccggtcgtgggttggcttgcccattcattgaggttgagattattggatgcgattatgat
gatggaaaagttaaaacaccaaagaaagatgacaatggtttaaacccaacatgggacaac
agcagtagcacgaacaatgatagttcttttgattttgacatcctggtaccagacacagcc
ttcttaaggttcactgtgtatgatcaagatatgttcggcgatccaaactttctggccatg
gcgagcataccggtgccttgtgttaagtctggtctaaggtctgttccactaaaaaacaca
tacagtgaagacatcccgcttgctgctttgctggttcatctggatgtgagaagtgccaag
gaagaggatgatggcctgtatgactcaattcaacgcctcagagaccaaaccaaagaactt
caatctaaaataagcagccagcaatcttacaacccaacagacatgatgtcataccaccaa
caactgtgcgagacacagaaagcactttttatgcaaaatgaacagagaaaggaaaggatg
attcagcgtctaaggcattga

DBGET integrated database retrieval system