KEGG   Ciona intestinalis (sea squirt): 100179207Help
Entry
100179207         CDS       T01056                                 

Definition
uroporphyrinogen-III synthase-like
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cin00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 251 aa AA seqDB search
MKIVLMRASTGCNDEYVNTLNKIGDVTSIPVLSFNFCNCDLIKDAISAPDSWSGIIFTSK
RSVEAVQLSLDTPLSELWASKPCYAVGESTAKMAENLGFISKGGNSGNAQVLAELIVQEQ
KLVNNQPLLFICGQLKRETLPSVLTCNEIPFHTITAYETVKNPVVDEAVQSYVEVNGSPD
FITFFSPSGHRFCFNTWQSALKGDFSATKIVAIGETTAHSFASQPDISVVTAERPNPESL
FKIIKANCESS
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaagattgtattaatgcgagcttcaactggctgtaatgatgagtatgttaatactctc
aacaaaattggtgatgtaacttctattccagttctttcttttaacttctgtaattgtgac
ttaattaaagatgcaatttcagcaccagattcttggtctggaatcatatttacaagcaag
cgatctgttgaagctgtacagctgtctctggatacaccactgtctgaattatgggcttca
aaaccttgttatgctgtgggagaatctactgcaaagatggctgagaatttaggatttatc
agcaaaggtgggaacagtggaaatgctcaagtgcttgcggaactaattgtccaagagcag
aagttagtaaacaatcaaccactattgtttatatgtggacagttaaaaagggaaactctt
ccatctgttttgacctgcaatgaaataccattccacaccataacagcatacgaaactgtt
aagaatccagtcgttgatgaagcagttcaaagttatgttgaagtgaatggctcaccagat
tttattacctttttcagtccatcaggtcatcggttctgctttaacacatggcaatctgcc
ctgaagggagacttctctgcaacaaaaatcgttgcaattggtgaaacaactgcacattca
tttgcaagccaaccagatataagtgtagtaactgcagaaaggccaaacccagaaagtcta
tttaaaatcataaaagcaaattgtgaaagctcttag

DBGET integrated database retrieval system