KEGG   Ciona intestinalis (sea squirt): 100179302Help
Entry
100179302         CDS       T01056                                 

Gene name
sos1
Definition
(RefSeq) son of sevenless homolog 1
  KO
K03099  
son of sevenless
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
FoxO signaling pathway
mTOR signaling pathway
Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:cin00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100179302 (sos1)
   04150 mTOR signaling pathway
    100179302 (sos1)
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    100179302 (sos1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 972 aa AA seqDB search
NPDPLVGNCFEEIAEGGEFGLYSDYTQNITDNRWNERFLSILHQTSVNSALKLVCEGFRD
VVTYVLPNLLLVPIYHCFYYFEQIQALEHSTNDSDDKEAFSQVVSAITPIKLILENRAAM
LPKNRPSEASLRISWRGGLQMEKMKDIEESIEGWWGKTITQTCNEFIYEGDLTRVMGKRS
SERRVFLFDSLLLCCKSNQARRPMPAVSPHEYRLKERILLRKSTVTDDESSDCQFSVDDG
ETKHIFCAHSSEEKRAWMAHLVRLQYRSTYDRMLDQLMREEASQLPVRYPSKEEYRYMEP
DSPDNLVLEGEGQIPQIKGGTVLKLVERLTYHLYYVPGFTKTFLTTFRSFCKPRLLLELL
VERYNIPEPPPTEAQLAAIERGEIVSRDDLKRFRKEYAQPIQLRVMNVIRQWLEHHWYDF
ESDWELLGSVRQFVSSVRGKNMQKWARTMEKIIAKKIASEEDIPMPSFRNDPPPVEWHIT
HDAEKYSIMSLHPIEVARQLTLLEFDLYRKVQSSELVGTVWTKVGKETSSPNLLRMIHWC
TTITRWVSRSIVETKNFEERTSVMSRAIEIMQVLKQLNNFNGLLEFVAAFNSSPIHRLNH
TKQHLPDRLVKGLKECMDLCDPRLTKCLEKLRSCDPPCVPFVGTFLTNILKTEEGNPHLL
PNYPEHLELINFGKRRMVAAIMQDIQQYQNQPYNLLPVNDIRDYLINLNPLEGQTEKQFN
DYIFACSLEVEPRQAERPARLPRSMSDKEMKSPGIVPSKKSGKTLFRDESKMSLFERRNS
TNEDEASTSTVENHPISVVPEEPPSPVPDEPRPPPRPPRQPIHDLVSAPPIMAQSTGVFT
FDHPPLVRGTSEAPRPLHNPPKDTPPPIPPRDVVYPPMQTFVQTEHEFFHNESMFQYHQP
LSAYPDVRYNPQDQPNEVEQFSQPEPRFVQEHGFIFPENNFTPSERGFPPEPPQIPDSAP
NQAPPVPPRDPL
NT seq 2921 nt NT seq  +upstreamnt  +downstreamnt
caaatcctgatcctctagttgggaattgttttgaggaaatagctgagggtggagagtttg
gtctttattcagattacacacaaaacatcacagataatagatggaacgaacgatttcttt
ccattctccatcaaacgagtgtaaattcagcactcaagttggtgtgtgaaggattcagag
acgtggtgacttacgtgctcccaaatcttcttcttgttccaatatatcattgtttctatt
actttgagcaaatacaggcacttgagcacagcaccaatgacagtgatgataaagaagcct
tcagtcaagtagttagtgcaatcactccaatcaaacttattcttgaaaaccgagctgcca
tgttacctaagaatagaccaagtgaagcaagtcttcgtatatcatggagagggggtttac
aaatggagaagatgaaagatattgaggaaagtatagaaggatggtggggaaaaaccatta
cacagacatgtaatgagtttatttacgagggtgacttaacgagggtaatgggtaaacgat
cttcggagcgtcgggtcttccttttcgattcacttcttctttgttgtaaatccaaccaag
cgcgacgaccaatgccggctgtgtctccgcatgaatatcgactcaaagagagaattttac
ttcgcaagagcacggtcaccgatgatgaaagttcagattgtcagttctcggtcgacgacg
gggagacaaagcacatcttctgtgctcattcaagcgaagagaaacgagcatggatggctc
atctcgtccgacttcaatatcgatccacgtatgatcggatgttggatcaattgatgaggg
aagaggcatctcaacttcctgttcgttatccatctaaagaagagtatcggtacatggagc
cagacagtccagataacttagtattagaaggtgaaggacaaatccctcaaataaaaggtg
gaacggtccttaaactggtggagagacttacctatcatctctactatgttcccggattta
caaagacatttctgacaacttttcgttcattttgtaaaccccggttgctgcttgagcttc
tagtagaaagatacaacatacctgaacccccaccaactgaagcacagttagcagcgatcg
aacgaggagaaattgtttctcgagatgatttaaaaagattcaggaaagaatatgcgcaac
ctattcaacttagagtgatgaatgtgatccgtcaatggttggaacatcactggtacgact
tcgaatcagattgggagctcttggggtccgtgcggcagtttgtgtcttctgtgagaggga
agaacatgcagaagtgggcgaggacaatggagaagatcatcgcgaagaagatcgcctctg
aagaggacatcccaatgccatcgttccgtaatgatcctccacctgttgaatggcacatca
ctcacgatgcagagaaatattcaatcatgtcattacatcctattgaggtggcgaggcaac
taactttgttggagtttgatctttacagaaaagttcaatcatctgagttggttgggaccg
tatggaccaaagttggtaaagagacatcgtcaccaaacttactgaggatgatacattggt
gtacaactattactagatgggtgtcaaggtctatagtggagacaaagaattttgaggagc
gaacatcagtaatgagcagagccatagaaataatgcaagttttaaaacaacttaataatt
ttaacggacttcttgagtttgttgctgcttttaattcatctcctatacatcgacttaatc
atacaaaacaacatttaccggatcgcttggtaaagggtttgaaggaatgcatggatctgt
gtgatcctaggcttactaagtgtttggagaagcttagatcgtgtgatccaccatgcgtgc
cttttgtgggaacattcctaacaaacatattgaagacagaggaaggcaatccacatcttc
tacctaattatcccgaacacctcgagttgattaactttggaaaaagacgcatggtagctg
caataatgcaagatattcaacaatatcagaatcaaccttacaacttgttgcctgttaacg
atatacgggattatctcataaatcttaatccacttgagggacaaactgagaaacaattta
acgattatatatttgcttgttcgttagaagttgaaccacgacaagcagagcgacctgcaa
gacttccgaggtcaatgtccgacaaagagatgaaatctcccggcattgttccgagcaaga
agagtggaaagactttattccgggatgagtcaaagatgtctctttttgaacgaagaaatt
ccaccaatgaggatgaagcatctacttcaactgtagaaaaccacccaatatctgtggttc
ccgaagaacccccatctccagtacctgatgaaccccgccccccacctagaccaccccggc
aacctattcacgatttggtatctgcacccccaataatggctcagagcacaggggtgttta
catttgatcacccaccattggttaggggaacttctgaagctccccggcccttacataacc
cccctaaggacacccctccccctatacctcccagagatgtggtttacccccccatgcaaa
catttgtgcaaactgaacatgaattctttcacaacgaatcaatgtttcaataccaccaac
cactatcagcctaccctgatgttcggtataatccacaagatcaaccaaacgaagttgaac
aattctcccaaccagagccgagatttgttcaagaacacgggtttatcttccctgaaaaca
atttcacccccagcgaacggggatttccccccgaacccccgcaaatcccagattctgccc
ccaaccaagctccacctgttcccccccgcgaccccctgtaa

DBGET integrated database retrieval system