KEGG   Ciona intestinalis (sea squirt): 100179302Help
Entry
100179302         CDS       T01056                                 

Gene name
sos1
Definition
son of sevenless homolog 1 (Drosophila)
Orthology
K03099  
son of sevenless
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
FoxO signaling pathway
Dorso-ventral axis formation
Jak-STAT signaling pathway
Class
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:cin04630]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:cin04068]
Organismal Systems; Development; Dorso-ventral axis formation [PATH:cin04320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 935 aa AA seqDB search
MRYFVKIFVYFGHPQLVCEGFRDVVTYVLPNLLLVPIYHCFYYFEQIQALEHSTNDSDDK
EAFSQVVSAITPIKLILENRAAMLPKNRPSEASLRISWRGGLQMEKMKDIEESIEGWWGK
TITQTCNEFIYEGDLTRVMGKRSSERRVFLFDSLLLCCKSNQARRPMPAVSPHEYRLKER
ILLRKSTVTDDESSDCQFSVDDGETKHIFCAHSSEEKRAWMAHLVRLQYRSTYDRMLDQL
MREEASQLPVRYPSKEEYRYMEPDSPDNLVLEGEGQIPQIKGGTVLKLVERLTYHLYYVP
GFTKTFLTTFRSFCKPRLLLELLVERYNIPEPPPTEAQLAAIERGEIVSRDDLKRFRKEY
AQPIQLRVMNVIRQWLEHHWYDFESDWELLGSVRQFVSSVRGKNMQKWARTMEKIIAKKI
ASEEDIPMPSFRNDPPPVEWHITHDAEKYSIMSLHPIEVARQLTLLEFDLYRKVQSSELV
GTVWTKVGKETSSPNLLRMIHWCTTITRWVSRSIVETKNFEERTSVMSRAIEIMQVLKQL
NNFNGLLEFVAAFNSSPIHRLNHTKQHLPDRLVKGLKECMDLCDPRLTKCLEKLRSCDPP
CVPFVGTFLTNILKTEEGNPHLLPNYPEHLELINFGKRRMVAAIMQDIQQYQNQPYNLLP
VNDIRDYLINLNPLEGQTEKQFNDYIFACSLEVEPRQAERPARLPRSMSDKEMKSPGIVP
SKKSGKTLFRDESKMSLFERRNSTNEDEASTSTVENHPISVVPEEPPSPVPDEPRPPPRP
PRQPIHDLVSAPPIMAQSTGVFTFDHPPLVRGTSEAPRPLHNPPKDTPPPIPPRDVVYPP
MQTFVQTEHEFFHNESMFQYHQPLSAYPDVRYNPQDQPNEVEQFSQPEPRFVQEHGFIFP
ENNFTPSERGFPPEPPQIPDSAPNQAPPVPPRDPL
NT seq 2808 nt NT seq  +upstreamnt  +downstreamnt
atgagatattttgtcaaaatatttgtttactttggtcatccacagttggtgtgtgaagga
ttcagagacgtggtgacttacgtgctcccaaatcttcttcttgttccaatatatcattgt
ttctattactttgagcaaatacaggcacttgagcacagcaccaatgacagtgatgataaa
gaagccttcagtcaagtagttagtgcaatcactccaatcaaacttattcttgaaaaccga
gctgccatgttacctaagaatagaccaagtgaagcaagtcttcgtatatcatggagaggg
ggtttacaaatggagaagatgaaagatattgaggaaagtatagaaggatggtggggaaaa
accattacacagacatgtaatgagtttatttacgagggtgacttaacgagggtaatgggt
aaacgatcttcggagcgtcgggtcttccttttcgattcacttcttctttgttgtaaatcc
aaccaagcgcgacgaccaatgccggctgtgtctccgcatgaatatcgactcaaagagaga
attttacttcgcaagagcacggtcaccgatgatgaaagttcagattgtcagttctcggtc
gacgacggggagacaaagcacatcttctgtgctcattcaagcgaagagaaacgagcatgg
atggctcatctcgtccgacttcaatatcgatccacgtatgatcggatgttggatcaattg
atgagggaagaggcatctcaacttcctgttcgttatccatctaaagaagagtatcggtac
atggagccagacagtccagataacttagtattagaaggtgaaggacaaatccctcaaata
aaaggtggaacggtccttaaactggtggagagacttacctatcatctctactatgttccc
ggatttacaaagacatttctgacaacttttcgttcattttgtaaaccccggttgctgctt
gagcttctagtagaaagatacaacatacctgaacccccaccaactgaagcacagttagca
gcgatcgaacgaggagaaattgtttctcgagatgatttaaaaagattcaggaaagaatat
gcgcaacctattcaacttagagtgatgaatgtgatccgtcaatggttggaacatcactgg
tacgacttcgaatcagattgggagctcttggggtccgtgcggcagtttgtgtcttctgtg
agagggaagaacatgcagaagtgggcgaggacaatggagaagatcatcgcgaagaagatc
gcctctgaagaggacatcccaatgccatcgttccgtaatgatcctccacctgttgaatgg
cacatcactcacgatgcagagaaatattcaatcatgtcattacatcctattgaggtggcg
aggcaactaactttgttggagtttgatctttacagaaaagttcaatcatctgagttggtt
gggaccgtatggaccaaagttggtaaagagacatcgtcaccaaacttactgaggatgata
cattggtgtacaactattactagatgggtgtcaaggtctatagtggagacaaagaatttt
gaggagcgaacatcagtaatgagcagagccatagaaataatgcaagttttaaaacaactt
aataattttaacggacttcttgagtttgttgctgcttttaattcatctcctatacatcga
cttaatcatacaaaacaacatttaccggatcgcttggtaaagggtttgaaggaatgcatg
gatctgtgtgatcctaggcttactaagtgtttggagaagcttagatcgtgtgatccacca
tgcgtgccttttgtgggaacattcctaacaaacatattgaagacagaggaaggcaatcca
catcttctacctaattatcccgaacacctcgagttgattaactttggaaaaagacgcatg
gtagctgcaataatgcaagatattcaacaatatcagaatcaaccttacaacttgttgcct
gttaacgatatacgggattatctcataaatcttaatccacttgagggacaaactgagaaa
caatttaacgattatatatttgcttgttcgttagaagttgaaccacgacaagcagagcga
cctgcaagacttccgaggtcaatgtccgacaaagagatgaaatctcccggcattgttccg
agcaagaagagtggaaagactttattccgggatgagtcaaagatgtctctttttgaacga
agaaattccaccaatgaggatgaagcatctacttcaactgtagaaaaccacccaatatct
gtggttcccgaagaacccccatctccagtacctgatgaaccccgccccccacctagacca
ccccggcaacctattcacgatttggtatctgcacccccaataatggctcagagcacaggg
gtgtttacatttgatcacccaccattggttaggggaacttctgaagctccccggccctta
cataacccccctaaggacacccctccccctatacctcccagagatgtggtttaccccccc
atgcaaacatttgtgcaaactgaacatgaattctttcacaacgaatcaatgtttcaatac
caccaaccactatcagcctaccctgatgttcggtataatccacaagatcaaccaaacgaa
gttgaacaattctcccaaccagagccgagatttgttcaagaacacgggtttatcttccct
gaaaacaatttcacccccagcgaacggggatttccccccgaacccccgcaaatcccagat
tctgcccccaaccaagctccacctgttcccccccgcgaccccctgtaa

DBGET integrated database retrieval system