KEGG   Ciona intestinalis (sea squirt): 100179353Help
Entry
100179353         CDS       T01056                                 

Definition
protein disulfide-isomerase A3
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cin00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100179353
Enzymes [BR:cin01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100179353
Exosome [BR:cin04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100179353
  Exosomal proteins of colorectal cancer cells
   100179353
  Exosomal proteins of bladder cancer cells
   100179353
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 476 aa AA seqDB search
MKHLFIALSALCVAIVSAADDVLVLTDSNFDAEIVKHSIILMEFYAPWCGHCKKLAPEYD
IAATKLKRNDPPIRIGKVDCTENTATCSKFGVSGYPTLKLFADGKLSKDYDGPRQADGIV
KYMQKAASPAAVLIETAAAHDKLLQKSSSVVVVGYFTDKAKATAFENVAKTLRDDYKFAY
TTSDDVMDAAGEKDTVKMYRPQAMANKFEESTMVIAGEPTVDGYRTFLNENALGRCGLLT
TDNYGKFKKPLVILAGSDVDYVKNIKGSNYWRNRVVKFGKEFKEQLTFGIANKDGIVGLL
PESGLPEDVSPVVVIVDAQDRKYVMPNAFSKDNFVAFLTSYTNGELSPFIKSEEPPADND
GPVTVVTGKTFDEIVMDESKDVLIEFYAPWCGHCKSLEPKWNELGEKMKDNNDIVIAKID
ATANDSPSQFQVSGFPTIYFAPKGNKQNPVKYQGGREVADFSKYLKENASKGKSEL
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaagcacttatttattgcgttgtcggccttatgtgttgctatcgttagcgctgctgat
gatgtcctcgttttaaccgacagcaacttcgatgctgaaattgtcaaacattcaattatt
cttatggaattctacgccccgtggtgtggccactgtaaaaaacttgcacccgaatatgac
attgctgccaccaagttgaagagaaatgatccaccaatcagaattggaaaggttgattgt
actgagaacacggcaacttgctctaagttcggagtgagcggttatccaacattgaaatta
tttgccgatggcaagctgtccaaagattacgatggcccacgtcaagcagatgggattgta
aagtacatgcagaaagctgcttcaccagctgcagttctcattgaaacagcagcagcacac
gacaaactcctgcagaaatctagttctgtagtagttgttggttacttcactgataaggct
aaggcaactgcttttgaaaatgttgcgaaaacccttcgtgacgattacaagtttgcatac
accaccagtgatgacgtaatggacgctgctggtgagaaagacaccgttaagatgtaccga
ccacaagccatggccaacaagtttgaagaatcaaccatggttatagcaggagaaccaacc
gttgatggttacagaactttcctcaacgaaaatgctcttggtcgttgtggacttcttacc
accgacaattatggcaagttcaagaaaccacttgttattctcgccggttcagatgttgat
tatgtgaagaatattaaaggatcgaactactggagaaaccgtgtggtaaagtttggaaaa
gaattcaaggaacaactcacttttggcattgctaacaaagatggcattgttggtttgttg
ccagaaagtggtttgcctgaagatgtttcaccagttgtcgtgattgttgatgcacaagat
agaaaatatgtgatgcccaatgctttcagcaaggacaactttgttgccttccttacttct
tacactaacggtgaattgagtccattcatcaaatctgaggaaccaccagcagataatgat
ggccccgtcaccgtggtaactgggaaaacattcgatgaaatagtgatggacgagagcaaa
gatgtcttgattgagttttatgctccatggtgcggacactgcaagtctctggaaccaaaa
tggaatgaacttggtgaaaagatgaaggacaacaatgacattgtgattgctaagattgac
gcaacagccaatgattctccatctcagttccaagtatccggatttccaaccatatacttt
gctcccaagggaaataagcagaatccagtcaaatatcaaggtggtcgagaggttgcagac
ttcagcaagtacttgaaggaaaatgcatccaagggaaaatctgaattgtaa

DBGET integrated database retrieval system