KEGG   Ciona intestinalis (sea squirt): 100179363Help
Entry
100179363         CDS       T01056                                 

Definition
ubiquitin carboxyl-terminal hydrolase 40-like
Orthology
K11869  
ubiquitin carboxyl-terminal hydrolase 40 [EC:3.1.2.15]
Organism
cin  Ciona intestinalis (sea squirt)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 749 aa AA seqDB search
MFGNLFEDGSNMACRNAKSVLSINGKPIEQPPEERGEQSLIGIQNQGATCYLNSLIQTLF
LTPEFREQLFDIGCEELGKSGPNKKDGKVRKIPLQLQLLFARLLLINQSSCKTEDLTDSF
GWRNSEEMQQHDVQELSRILFDAIENSLVGTSGDKLIHNLYNIANHAIQYSPFTDKPPCT
EYSLYSVIIHTGNAHRGHYHAYIRDVDGLEKAKLPIVDPEPDFEMSTTTSKAPTMVVVQK
RSEPVNPNDNIEETLACLIAQQGSVKLDQLSMKLRYETGISWNKKYRKKHGSLSKFLLSC
PNTFVVDNENNSVYLCSQPSEDSNQKLITNQLENINGSQQFPEALNHSMINLSLEEKDEK
IGLFGGTNDVEEDAAPTSPDLSTDAGSDNKETAVPQDVNPAGHSWFDFNDERVTEISVNS
ITNQFEGQQSAYMLFYRRKDLIRPDSSFGNSMYKIPKHVVEQIQEENIKLQNWREDYEKA
SNRLDLYIHTENMCFVSNGLIQTSNPEGHLLQIDQRETVDDLLSKISQEQSTFFRRPKPK
LKLKKKYEDSSLKPSTQCVNTLHYMKVLPHAGIHLYECTSVRKDVSLYEAGIQSQVHLFA
WDGDKILGSNVAPGEENEPVLHHLICQHPDFTRRVSFSLPKSQPPDVIRERAAELMLTQQ
IEVKEMVQDEVDNLETEGNKEEYEMEKYVKNYVADIVRSEEENEIKESSVEAQEDTISVH
VKVRNLGLHQSLKDVVTDFKVDKSMVRIN
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atgtttggtaacttatttgaggatggtagtaatatggcttgtagaaatgctaaatccgtt
ctttcaataaatgggaaacctattgaacaaccaccagaggaaaggggggaacaaagtctg
attggaattcaaaaccagggagctacatgctacctcaactcactgattcagacgctgttc
cttaccccagaatttcgtgagcagctgtttgatattggctgtgaggaattgggaaaatct
ggacctaataagaaagatggaaaggtgcgtaagattccacttcagcttcaacttttgttt
gctcggttacttttaataaatcagtcaagttgcaaaacagaagacttgaccgacagtttc
ggatggagaaacagtgaagagatgcagcaacatgatgtgcaagaattaagtcgtattcta
tttgatgccattgaaaattctttggttggaacatctggtgataaattaattcacaatctt
tataacattgcaaatcatgcgatccaatattcccccttcacagataagccaccatgcaca
gaatattctttatattctgtcatcattcacactggaaatgcacatcgtggtcactaccat
gcctatataagggatgtggatggattggaaaaagcaaaacttccaattgtggatcctgaa
cctgattttgagatgtccacaacaacatcaaaagccccaacgatggtagttgtacaaaaa
cgaagtgaacctgtcaatccaaatgataatattgaagaaacacttgcttgcttaattgct
caacaaggcagtgtaaagttggaccaactgagcatgaaactgcggtatgagactggtatc
tcctggaacaagaaatatcgcaagaaacacggatctttgagcaaatttcttctttcctgt
cctaacacattcgtggtggataacgagaacaactcagtctatctatgcagccaaccaagt
gaagacagtaatcaaaaactgattacaaatcaactggaaaacataaacggtagccaacag
ttcccagaagcactgaaccattccatgataaatttatcgctggaggaaaaagacgaaaaa
atcggtttattcggaggaacaaatgatgtagaagaggatgctgctcctacatctccggac
ctttctactgatgcgggttcagataacaaagaaacagcagttccacaagacgttaaccct
gctggccattcctggtttgatttcaacgatgaaagagtgactgaaatcagcgttaattca
atcacaaatcaatttgaaggacagcagagtgcttacatgcttttctacagacgtaaagat
ttgatccgaccagattcaagttttggcaactctatgtacaagatacccaagcatgtggtt
gaacaaatacaagaggaaaatataaagcttcagaactggagggaagattatgaaaaagca
tcaaatagacttgacttatacatacacactgagaacatgtgttttgtttcaaacggtttg
atacaaacaagcaatcctgaaggtcatttgcttcaaattgatcaaagggaaacagttgac
gatttgctgagcaaaatttcccaggaacagtcaacgttttttcgccgacccaaaccaaaa
ctaaagttaaaaaagaaatatgaagattcaagcctgaagccaagcactcagtgtgtgaat
accttgcactatatgaaggtgcttccccatgcgggaattcacctgtatgaatgcacatct
gtgagaaaagatgtgagcttatatgaagctggtattcaatctcaggttcatctatttgca
tgggatggtgataagattctgggatcgaatgttgctcctggagaggagaatgagccagtc
cttcatcacctcatctgtcaacatccggatttcactcgtcgcgtttccttttctcttccc
aaatcacagccaccagatgtcatcagggagcgagctgctgaattaatgctgactcagcaa
attgaagtgaaagaaatggttcaagacgaagtggacaatttagaaacagaaggcaataaa
gaggaatatgagatggaaaagtatgtgaaaaattatgttgcagacattgtgagatcagaa
gaggaaaatgagataaaggaatccagtgtagaagcacaggaagatacaatatctgttcat
gttaaagtgaggaatcttggattacatcagagcttgaaagatgttgtaactgattttaaa
gttgacaaatcaatggtaagaataaactaa

DBGET integrated database retrieval system