KEGG   Ciona intestinalis (sea squirt): 100179671Help
Entry
100179671         CDS       T01056                                 

Definition
gem-associated protein 7-like
Orthology
K13135  
gem associated protein 7
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
RNA transport
Module
Survival motor neuron (SMN) complex
Brite
KEGG Orthology (KO) [BR:cin00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100179671
Spliceosome [BR:cin03041]
 Other splicing related proteins
  Proteins involved in snRNP biogenesis
   SMN complex factors
    100179671
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
10
AA seq 86 aa AA seqDB search
MEKEQETRALLRKKFLKSILFAKDKEVVFNLHENTTVLGKFKSCDYDPVQILVADLQTPS
GTINEALLRTSDIISYTVDLPKDNTT
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
atggagaaagaacaagaaacacgggctcttctaagaaagaagtttttaaaatcaattttg
tttgcaaaagataaagaagttgtatttaacctgcatgaaaacacaacagtgctgggaaaa
tttaaaagttgtgattatgatccggtacaaatactagtagcagatttacaaactccatct
ggaactataaatgaagctttactaagaacttctgacattatttcctatacagttgatcta
cctaaagataatacaacatga

DBGET integrated database retrieval system