KEGG   Ciona intestinalis (sea squirt): 100179799Help
Entry
100179799         CDS       T01056                                 

Definition
xylose isomerase-like
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100179799
   00051 Fructose and mannose metabolism
    100179799
Enzymes [BR:cin01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     100179799
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 456 aa AA seqDB search
MSSFAPASGKSDLAEAGSLLTKYPLEVKKIPYKPDAKVDDVLCFRHYNESEVVMGKPMSD
WLRFSVCYWHTFRGTGADPFGFPTLVRPWDDGTDSIENAERRMRVAFDFMSKLGVKYWTF
HDRDIAPEGVTLSETNANLDRLAELASQLQGETGIKLLWNTCNLFAHPRYSNGAATNADA
HVVAYAAAQVKKSLEIGKKLGAENFVFWGGREGYHTLLNTNVREELDNLANFFKMVVAYK
KKIGFTGQFLIEPKPKEPSKHQYDYDAMTVIAFLKTYDLDKDFKLNIEPNHTTLAGHCHE
HDVVMASAYNMLGSVDSNTGSPDLGWDTDQFPMDVKNATMIMQTVLEQGGLAPGGLNFDC
KVRRESTDVIDMMIAHVGAMDCFAKALKIAAKIREDGVLGKMKKERYASFGSGLGLKIKT
GTATLEECDSFIQENGEPAKLSGKQEMFEAVLNRYF
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcgtttgctccagcatctggaaagagcgatttggcggaagctggaagcttattg
acgaagtatccgctggaagtcaagaaaatcccgtacaagcctgatgccaaagtagacgat
gttttgtgcttccgacattacaacgaatcagaagtcgtcatggggaaaccgatgagcgat
tggcttcgtttctcggtttgctactggcacacgtttaggggaacaggggcagatccattc
ggattccctacattggtacgaccatgggatgatgggacagacagcattgagaatgcagaa
cgacgtatgagagtcgcgtttgatttcatgtcgaaactcggtgtcaagtactggaccttc
cacgaccgagatatagcaccagaaggggtgactctttctgaaacaaatgcaaatcttgac
cgtttagcagaattagccagtcagttacaaggcgagactggtattaaattgttgtggaat
acgtgcaatttatttgcacatcctaggtacagcaacggtgcagcaaccaatgccgacgca
cacgtggttgcatacgccgccgctcaggtgaaaaagtcacttgagatcggcaagaagttg
ggtgccgaaaactttgtgttttggggtggcagggaaggttatcatacattgctaaacacg
aatgttagagaggaacttgacaacttagcgaacttctttaaaatggtcgtcgcttataag
aaaaagatcggatttactggccaattcctaattgaaccaaagccaaaagagccgtcaaaa
caccaatatgattacgatgcaatgacagtgattgcgtttctgaaaacctacgatctggac
aaagattttaaattaaacatcgagccgaaccacaccacgcttgctggccactgccatgaa
cacgacgttgtcatggcgtctgcatacaacatgcttgggtctgtggattcgaacacagga
tcccctgaccttggctgggacacggaccagtttccaatggacgtaaagaatgcgaccatg
attatgcagacagtgttagagcaaggtggtctcgctcccggtggtttaaactttgattgc
aaagtgagacgcgaatcaaccgatgttatcgacatgatgatcgcccatgttggagcaatg
gactgctttgccaaagctttaaagatagctgccaaaatacgtgaagacggggtgcttggg
aagatgaaaaaggaaaggtacgcgagctttggcagcggacttggattgaaaatcaaaaca
ggaactgcaacactggaggaatgtgacagctttattcaagaaaatggggagccagccaag
ttgtctggaaagcaagaaatgtttgaagcagttttaaaccgatatttttag

DBGET integrated database retrieval system