KEGG   Ciona intestinalis (sea squirt): 100179846Help
Entry
100179846         CDS       T01056                                 

Definition
(RefSeq) lymphokine-activated killer T-cell-originated protein kinase-like
  KO
K08865  PDZ-binding kinase [EC:2.7.12.2]
Organism
cin  Ciona intestinalis (sea squirt)
Brite
Enzymes [BR:cin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100179846
Protein kinases [BR:cin01001]
 Serine/threonine kinases: Other
  TOPK family
   100179846
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH APH_6_hur RIO1
Motif
Other DBs
NCBI-GeneID: 100179846
NCBI-ProteinID: XP_002121200
Ensembl: ENSCING00000013061
UniProt: A0A1W2W7V1
Position
9
AA seq 344 aa AA seqDB search
MQFDVSNCTPLRHGRVRTLLNESSLASSPSLQIPASPFMKHLGFGTGVNVYLIERSPRQG
QYRSPWAIKKINKKCGGNEMTYIERLKEEAAILKSLHHKNIVGFRSFTKSEDGTLCLAME
DGEKSLFSMIEDRMSTETGPFPVQCILEVAAQVSSALAYLHNEKRILHGDLKSANILVQG
DFEVVRICDFGVTIQLNELLEASDPEAQYVGTESWCSKDVMDGGVISDKTDIYAYGMILY
EMLTLVIPHMHVFPEEEDFSITEEFEREFEQAEIEYQNSLGTRPPLLNYQYDIAYQSVIE
LFWACSQSAPEDRPSAAQIVEGLKQHTEIESYIAMPDPKGKLEF
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgcaattcgatgtaagtaactgcacgccattgcggcatgggcgagtccggacattgttg
aacgaatcgtcattagcgtcatcaccttctttacaaattcctgcttcaccattcatgaag
catttaggattcggaactggtgtgaatgtttatttgattgaaagatcgccacgtcaaggc
cagtatagatcaccgtgggcaattaagaagataaataaaaaatgcggtgggaatgaaatg
acctacatagaaaggttaaaagaggaagcggccatcttaaaaagtcttcaccacaaaaac
attgtaggttttcgaagctttacaaagtcagaggatggaactttgtgtttggcgatggag
gacggagagaaatctttattttctatgattgaagatcgaatgtcaacagagactggaccg
tttccagttcaatgcattcttgaagttgctgcccaagtgtcaagtgccttggcttatttg
cacaatgaaaagagaattttacatggagatttaaagagtgctaatatacttgtacagggt
gattttgaagtcgtaagaatctgtgattttggagttacaattcaacttaatgaactcctt
gaagcttcagatccagaggcacagtatgtggggacagaatcatggtgttcaaaagatgta
atggacgggggtgtcataagtgacaaaactgacatctacgcatatgggatgatactgtat
gagatgttaactcttgtgattcctcatatgcatgtcttccctgaggaagaagattttagc
atcacagaagagtttgagagggaatttgaacaagcagagattgaatatcaaaacagtttg
ggaacaaggcctccattactaaattaccagtacgacattgcgtaccagtctgttattgaa
ttgttctgggcttgtagtcagtctgcacctgaagatcggccttctgcagcacaaattgtt
gaaggtttaaaacaacacacagaaattgaatcctacattgcaatgccagatcccaaagga
aagctggaattttaa

DBGET integrated database retrieval system