KEGG   Ciona intestinalis (sea squirt): 100179857Help
Entry
100179857         CDS       T01056                                 

Definition
histone acetyltransferase KAT8-like
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
cin  Ciona intestinalis (sea squirt)
Brite
Enzymes [BR:cin01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100179857
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
4
AA seq 464 aa AA seqDB search
MDGENSTAEPSAPEATVKPAQQPDKPVIPEESTPQTSSLKLKTKCESESHDSKIVIGGQY
YCQRSDSTEHIAEVIQKRVNPLRGDLHEYYVHYRGYNRRLDEWVEAGRFDLTKVVQENNA
TVVKPGDPNENADNRMTRNQKRKHDEINHVQKSYAEMDPTTAALEKEHEAITKIKYIDRI
QLGKYEIDAWYFSPYPDEYGKQPKLNVCEYCFKYMRFESTYRKHLSDCTWRQPPGREIYR
KSTISVYEIDGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFLFYVMTEVDRNGAHTVGYF
SKEKESPDGNNLACILILPPFQRKGYGKFLIAFSYELSKVEGQIGSPEKPLSDLGKLSYR
SYWTWVLLEILRDFRGTLSIKDLSEMTSITQADIISSLQSLNMVKYWKGQHVICVTQKHI
EEHLRSQYFKRPRLPVDSAFLKWSPPKKKPPPPKNVLHHKKSNQ
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggatggtgaaaatagtactgctgaaccaagtgctccagaggcaacagtaaaacctgca
cagcagcctgataaacctgtaatacctgaagaatcaacaccacaaacgtcgtctttaaaa
ctgaaaaccaaatgtgaaagtgaaagccatgatagtaaaattgtcattggtggccagtat
tactgtcagcgcagtgatagtactgagcacatcgcagaagttattcaaaaacgggtaaac
ccactgagaggggatttgcatgagtactatgttcattatcgtggctataataggaggttg
gatgagtgggttgaagcgggacgttttgacctcacaaaggtagtgcaggagaacaatgct
acagtggttaagcccggagatccaaatgaaaatgctgacaatcgtatgacccggaatcag
aagcgaaagcatgatgaaatcaaccatgtgcaaaagtcatatgctgaaatggatcccaca
actgctgcattagagaaagagcatgaagctattacaaaaatcaagtacattgaccggatt
caactggggaaatatgagattgatgcttggtacttttcaccttacccagatgaatatggg
aaacagccaaagttaaacgtgtgtgaatactgtttcaagtatatgaggttcgaatccaca
tacagaaagcatttgtcagattgtacatggagacaaccgcctgggagggagatttacaga
aaaagcacgatatctgtgtatgaaatagatgggaaagaccataaaatttactgccaaaac
ctgtgcctgcttgcaaagttgtttctagatcataaaacattatattttgatgttgaaccc
tttctgttttacgtgatgacagaagtggatagaaatggtgctcacacagttggatacttt
tcaaaggagaaggaatcaccagatggcaacaacctggcttgtattttaatcctgccacca
tttcagagaaaaggatatggtaaatttcttatcgcttttagctacgagctgtcaaaagtt
gaagggcaaattggatcaccagaaaaacctctttctgacctcggaaaactcagctacaga
agctactggacatgggtgctgcttgaaattttaagagacttcaggggcactttgtctata
aaggatttaagtgaaatgacaagcattacacaagcagatattatttcttctctccagtct
cttaacatggtcaagtattggaaagggcagcatgtcatttgtgtaacccagaaacacata
gaagaacatctcagatcacagtattttaaacgacctcgtttaccagtggacagtgctttt
ctaaaatggtcaccccctaaaaagaagccaccacccccaaaaaatgtgttgcaccataaa
aagtcgaaccaatga

DBGET integrated database retrieval system