KEGG   Ciona intestinalis (sea squirt): 100180070Help
Entry
100180070         CDS       T01056                                 

Definition
(RefSeq) dual specificity tyrosine-phosphorylation-regulated kinase 4
  KO
K08825  
dual specificity tyrosine-phosphorylation-regulated kinase 1 [EC:2.7.12.1]
Organism
cin  Ciona intestinalis (sea squirt)
Brite
Enzymes [BR:cin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100180070
Protein kinases [BR:cin01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   100180070
Membrane trafficking [BR:cin04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    100180070
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
11
AA seq 883 aa AA seqDB search
MDVSSRFVHLTLIVQGLQLNPTTLTPMTPKATAAHPAPKKPILPRTPPHPQNDIKPWTPQ
SGASPLDYDDIDLDLSLPETPPPTPQITTDRHPQRPDGPLLLRQRPNTGTTQPKIVGKRR
GLKPKKSFLATVAMANVSNGQRDPQARYHGDSNAKTQVITFEDIFGLRPNQQNSSTFGKS
HFPSSEGVLQQNKSYQQHGLGSRRNAGKSLVHHTHENYSSGVTHLPHLVDHHHHQHGSTV
TSGSGQVQLPPTKLPSAKAMGYKSMAGGLPLHAGASNRHMGAFPDTGNGLNRSSTFTGHN
LFSKTRHNASNRHVAASQSNSFDVGLSETGNTRENVVGRVFEGRKLPMSSDEAVKVFGSR
LTTFEQSEIVDYNDIWFLGLDGKKVQGVHGASQNCGYDDENGSYIKVLHDHMIYRYEVLE
VIGKGSFGQVVKALDHKTNTLVAIKIIRNKKRFHHQALVEVRILDALRRNDKDGGHNVIH
MMESFYFRNHLCITFELLGMNLYELIKKNNFQGFSLPLIRRIAHALLKCLCLIYKERIIH
CDMKPENILIRQKGQSSIKVIDFGSSCYEHRRVYTYIQSRFYRSPEVILGHQYSMAIDMW
SFGCILAELYTGYPLFPGENEVEQLACIMEVLGLPPSDYIETAQRKRLFFDSKGQPRCIT
NSKGRKRRPNSKDISTAVRTSDPVFLHFLRRCLEWEPSKRMTPDEAMHHEWIVEGRFQKT
RGQSRHVGKKSIVPGSNTKPVSATNNSNNTTDTEKASNLQPEKTVQPSSGTRKGKSGKNT
TAKIKEETTEGGNDGTGQSTDHSGENNRSTETFSDEDASRERLQPIGASNTSMLADDVEN
GDIEAEKTAAKESTKNPQKQTSAKENQENKLIVPEATKLPPIA
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atggacgtttcgagtaggtttgtgcatttaaccctcattgttcaaggtttgcaacttaac
cccacaaccctcacccctatgacccctaaagccaccgccgctcaccctgcccctaagaaa
cccatcttaccccgaacaccccctcacccccaaaacgatattaaaccttggaccccacaa
agcggtgcttccccgcttgactatgacgacatagacctggatctaagtttaccggaaacc
cccccacccacccctcaaattacaaccgaccgccaccctcagcgaccagacgggccgctt
ctgttacgtcaaagaccaaacactggcaccacccaaccaaaaatcgtcggcaaacgtcgc
ggattgaaacctaaaaaatcgtttttagctactgttgccatggcaaatgtttcaaacggt
caacgcgaccctcaagcacgttaccatggcgactcgaatgctaaaactcaagtaattaca
ttcgaggatatatttggtttgcgaccgaatcagcagaactcaagcacattcggtaaaagt
cattttccatcaagcgagggggttctacaacaaaacaagtcgtaccaacagcatggtctt
ggatcgaggagaaatgctggaaaaagtttagttcaccatacgcatgagaactattcgtcc
ggtgtgactcacctgccccacctcgtggatcatcaccaccaccaacatggatccactgtg
acgtcaggatccggtcaagttcaacttcctcctaccaagctaccgtcagccaaagccatg
ggttacaagtccatggcaggcggtcttcctttgcatgcgggggcgagcaacagacacatg
ggggctttccctgatacgggaaacggtcttaacaggagtagtacgttcacaggtcacaac
ttgttcagtaaaacacgtcacaatgcctctaatcgacacgtagctgcgtcacaaagcaac
tctttcgatgttgggttgtcagaaacggggaatacccgggagaacgtagtgggacgagtt
tttgaaggaaggaagttaccaatgtcttctgacgaagctgtaaaagtattcggatcccgc
cttacaactttcgaacaaagcgaaatcgtcgactacaatgatatttggtttctcggtttg
gacggcaagaaagtccaaggagtgcatggagcctcacagaactgcggctatgatgacgaa
aacggctcttacatcaaggttcttcacgaccacatgatataccgatatgaagtgttagaa
gtgattggaaaaggatcgtttggtcaagttgttaaagcacttgaccataagaccaacaca
ctggttgcaataaagataataagaaacaaaaaaaggtttcaccatcaagcacttgtggaa
gttcgaatcctagatgcgctgaggcgtaatgacaaagatggaggacacaatgttattcac
atgatggagtcgttctatttccggaaccatctctgcattacatttgagttgcttgggatg
aacctttatgagttaataaagaagaacaatttccaaggcttcagtcttccactgatacgt
cgtatcgcacatgctttactcaagtgtctctgccttatctacaaagagaggatcatacac
tgtgatatgaaaccagaaaacatcctgattcgacagaaaggtcaaagttcaatcaaggtc
attgactttgggtcaagttgttacgaacatcgacgtgtatacacatacatacaaagtcgt
ttctaccgatcccctgaagttatcttgggccaccaatacagcatggctattgacatgtgg
agctttggatgcatcttagctgagctgtatacaggctaccccttgtttcctggagaaaat
gaagtggaacaacttgcttgtattatggaggtcttaggactcccaccttcagattatatt
gaaacagcccagaggaaacggcttttctttgattcaaaaggtcagccaagatgtataacc
aacagcaagggtaggaaacgtcgaccaaactccaaagacatcagcactgctgttcgtaca
agcgaccctgtgttcctgcatttcctaaggaggtgtttggaatgggagccatccaagaga
atgacaccagatgaggcgatgcatcatgaatggattgtagagggaaggttccagaagaca
agaggtcaatccaggcatgttgggaagaagtccattgtacctggtagcaatacaaagcca
gtgtcagcaacaaacaacagcaataatacaacagacactgaaaaagcctcaaaccttcaa
ccagagaaaacagtgcagccttcaagtggcactaggaaggggaaatccggaaaaaacaca
acagcaaaaattaaagaagaaaccacagaaggtggtaatgatggtaccggacaatcaacg
gatcatagtggggaaaataatcgctctacagagacatttagtgatgaagatgcaagtcga
gagcgattacaaccaattggagcatccaacaccagcatgttggcagatgatgtggagaat
ggagacatagaagcggagaaaacagctgccaaggaatcaaccaaaaacccccaaaagcaa
acaagtgcaaaagaaaaccaggaaaataaactcatagtacctgaagctaccaagctacca
cctatcgcttga

DBGET integrated database retrieval system