KEGG   Ciona intestinalis (sea squirt): 100180070Help
Entry
100180070         CDS       T01056                                 

Definition
uncharacterized LOC100180070
Orthology
K08825  
dual specificity tyrosine-phosphorylation-regulated kinase 1 [EC:2.7.12.1]
Organism
cin  Ciona intestinalis (sea squirt)
Brite
Enzymes [BR:cin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100180070
Protein kinases [BR:cin01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   100180070
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
11
AA seq 183 aa AA seqDB search
MTPDEAMHHEWIVEGRFQKTRGQSRHVGKKSIVPGSNTKPVSATNNSNNTTDTEKASNLQ
PEKTVQPSSGTRKGKSGKNTTAKIKEETTEGGNDGTGQSTDHSGENNRSTETFSDEDASR
ERLQPIGASNTSMLADDVENGDIEAEKTAAKESTKNPQKQTSAKENQENKLIVPEATKLP
PIA
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgacaccagatgaggcgatgcatcatgaatggattgtagagggaaggttccagaagaca
agaggtcaatccaggcatgttgggaagaagtccattgtacctggtagcaatacaaagcca
gtgtcagcaacaaacaacagcaataatacaacagacactgaaaaagcctcaaaccttcaa
ccagagaaaacagtgcagccttcaagtggcactaggaaggggaaatccggaaaaaacaca
acagcaaaaattaaagaagaaaccacagaaggtggtaatgatggtaccggacaatcaacg
gatcatagtggggaaaataatcgctctacagagacatttagtgatgaagatgcaagtcga
gagcgattacaaccaattggagcatccaacaccagcatgttggcagatgatgtggagaat
ggagacatagaagcggagaaaacagctgccaaggaatcaaccaaaaacccccaaaagcaa
acaagtgcaaaagaaaaccaggaaaataaactcatagtacctgaagctaccaagctacca
cctatcgcttga

DBGET integrated database retrieval system