KEGG   Ciona intestinalis (sea squirt): 100180112Help
Entry
100180112         CDS       T01056                                 

Gene name
pik3cg
Definition
phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit gamma
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Inositol phosphate metabolism
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100180112 (pik3cg)
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    100180112 (pik3cg)
   04068 FoxO signaling pathway
    100180112 (pik3cg)
   04070 Phosphatidylinositol signaling system
    100180112 (pik3cg)
   04150 mTOR signaling pathway
    100180112 (pik3cg)
Enzymes [BR:cin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100180112 (pik3cg)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
8
AA seq 1131 aa AA seqDB search
MSQSPKLSLSVPPDAFDTGSSDGEPFSPLPPEIQRLRNDSDPKSEFRRKKSRIVRQNPIP
KVPVGFFSIIRTMTVDFVLPNEKTVTLNCVGNQTVGQIKSDLLERIRDQYLAYEKVWEHE
LLLTYTIDGKTYEICDMHQTFQTLRVINMWTKTGLKGTLDVRHLTAESNEERLFNLTLGS
LMGVIWGKYGSMVKHNTAVTDDEVYVTRRKLTNVRRRALRSRFPSTYSMEPILDHTTPPT
HVKANFQEDETITVCIYGPSKSSTTMSVGVYDPPSKIMEDFFESLTPARKIAFGIPEEAK
APDYVLKVCGMCDYIWGPHEIMDFVYIRHCVARRREPQLALCVPPNDAEDEVLSVHDPWF
FVDDSTGVTENHQQLTLVGCKKNHTEIVAFSLWDMTRKFRIKVLGVDYLTPENETVGTPD
ELYVEFSLYSGRQRLAEPVRTKPVASNADLRWYTSLEFDILLRNVPKEARLNANIIGIFR
TKSVKVKTGIKSVSSNGDQHVILRWANMQLLNHRSVLCTGRHAFKTWPMSYSEDVSVETH
TGTTAPNDGVESTSSTAEIHFELDSYMHPVVFPNGGWKTSNPEDQAPDPIHGSSDWKKLE
EIIQSDTLTELTLEDKALLKKYRSYCRGRANSLPKVLQAVDAASLDSVVDMHALLNKWPA
LSVEVALELLDSQYEDEKVRSLAVKTLKCLSNTKLHAYLLQLTQVLKFEPYHDSALARFL
LTRALQSKRIGHYFFWFLRSEIENPHVSQRYSILLEAYLRGCGSNMLKEFSKQCAVTNTL
KNFSSLISMKLSKNSNSGLKTEILREQLARISLPETFKAPFDPRITLGRLMAEKSKIMDS
KKKPLWLEFENADENVINESTSVIRIIFKQGDDLRQDMLTLQMLSLMGQLWNEEGLDLHL
LPYGCLSTGLQVGIIQIVPNATTVARIQKESGGLIRGTFKDEVLKKWLERKNPTTDRMNS
AVETFMLSCAGYCVATYVLGIGDRHNDNIMVTESGNLFHIDFGHFLGNTKRFYGIQRERV
PFVLTPDFVHVMGTEDGELFQRFMDTCVLAYLVIRRHAPLFINLFHMMKSTGIPELNSVR
DIRYLQNVLVLDKTEHEASQHFLSEIAGVLRKNWTVQVNWLMHRLVHSGSS
NT seq 3396 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagtctccgaaactaagtctatccgtgccccctgatgcgtttgacactggttcg
tcagacggagaacccttctctccacttcctcctgaaatccagcggcttcggaatgattcg
gatccgaagtctgagtttcggagaaagaaatctcgcatcgtccgccaaaacccaattcct
aaagttccggtcggattcttttctataattcgtacgatgacagttgactttgtacttccg
aatgagaaaactgtcactttaaactgtgtgggcaaccaaactgtcggtcaaatcaagagc
gatttactagaacgaatacgagaccaatatcttgcatacgagaaagtttgggagcatgag
ctgctacttacctacaccattgacggaaaaacttacgaaatctgcgacatgcaccaaaca
tttcagacgttgagagttattaacatgtggacgaaaactggactcaagggaacgttggat
gttcgacacctaacggcagaaagcaacgaagaaagacttttcaacttaaccctcggttcg
cttatgggggtgatttggggtaaatacggatccatggtcaaacataacactgcggttact
gatgatgaggtttacgttacaagaaggaaacttacaaatgttcggcgtcgagctttgagg
tcgaggtttccaagtacttactcaatggaaccaatactcgaccatacaacgccaccaacg
catgtgaaggcgaattttcaagaagacgaaacgataaccgtttgcatatatgggccaagc
aagagcagtacaactatgtcagtaggagtttacgatccaccctcgaaaattatggaggat
ttctttgaaagtcttacaccggcaaggaaaatagcgttcggaattcccgaagaagccaaa
gctccagattacgtgttgaaagtttgcgggatgtgtgattacatatggggacctcacgag
ataatggattttgtttacattcggcactgtgtagctcggagacgcgagccccaacttgct
ctatgtgttccccccaatgacgccgaagacgaagtcttaagcgtgcacgatccgtggttc
tttgtggatgattccactggtgtaaccgagaaccatcaacaactcacgctagtcggctgc
aagaagaaccacacagaaatcgtggcgttttcgctctgggacatgacgcgaaagtttaga
ataaaagttttaggtgtggactaccttacacccgagaacgaaacggttgggacaccggac
gagctttacgttgagttttcgctttacagcggaagacagagattagcggaacctgtacga
actaaaccagttgcttccaacgccgatctaagatggtatacttcattagaattcgacatt
ttgcttcgaaacgttccaaaagaagcaagactgaacgcgaatattattggtattttccgg
acaaagtcggtaaaagtgaaaacgggaatcaagtccgtgtcctcgaacggagatcaacat
gttatactacgatgggctaatatgcaacttttaaatcatagatcagtgttgtgcactggg
cgtcatgctttcaaaacctggcctatgtcgtacagtgaagatgtgtcagttgaaacacac
actggaaccactgctccaaatgacggggtagaatccacaagtagcacggctgaaatacat
tttgagcttgactcttacatgcatcctgtagtcttccctaatggaggatggaagacctca
aacccagaagatcaagctccagacccaatccatggatcctcggattggaagaagttggaa
gagatcattcaatctgatactcttactgaactaacactggaggataaggctcttcttaag
aaatacagatcttactgcagaggaagagccaattcgttgcctaaagttttgcaagcagtt
gatgctgctagtttggatagtgtggttgacatgcacgccttgctgaataagtggccggct
ttatcagtagaggtagcactggagctactggactctcaatatgaagatgagaaagtacgt
agtttggccgtgaaaactctcaagtgtttgagcaacaccaaacttcatgcttaccttctg
cagctaactcaggttttaaaatttgagccatatcatgacagtgctttggcccgttttctc
ctcacgagggcactgcagagcaagagaatcgggcattacttcttctggtttctcagatcg
gagattgaaaaccctcatgtcagtcaacgttattcgatcttgctcgaagcatatctacgt
gggtgtggaagcaacatgctgaaagaattttctaaacagtgcgcggttactaacacgctg
aaaaacttttcttcactaatctcgatgaaattgagcaaaaactccaacagtggcctcaaa
actgaaatattacgagagcagttggcgagaataagccttccagagacttttaaggctcca
tttgatccaaggattactctcgggcgtctaatggcagaaaaatccaaaatcatggattct
aaaaagaaacccttgtggctggaatttgaaaacgctgatgaaaacgttattaatgaatct
actagtgttataagaataatcttcaaacagggtgatgatttacgacaagatatgttgact
ctgcaaatgttgtcgcttatgggtcaactatggaatgaagaaggattagacttgcatctc
ctgccttatggatgtctaagtacaggtcttcaagttggcatcatccagatcgttccgaat
gcaaccactgttgcccgcatccagaaagagtccggaggacttatccgtgggacgttcaaa
gacgaggttctgaagaaatggctggaaagaaagaatccaacgactgacagaatgaattcc
gccgtggagacgttcatgttatcttgtgctggttactgtgtggctacttatgttttaggc
attggagaccggcataatgataatattatggtgacggagtccggcaatttattccatatc
gacttcgggcatttcctcggaaacacaaaaaggttttacggcattcaacgagagcgtgtg
cctttcgttttaaccccagatttcgttcatgttatgggaacagaagatggggaattattc
caacgttttatggatacctgcgtgcttgcatacttagtaatacgcagacacgcacctctt
tttatcaacctctttcacatgatgaagtcaacagggataccagaacttaattcagtcaga
gacattcgctatttacaaaatgttcttgttcttgataagactgaacatgaagcaagtcag
cattttctttcagaaatcgcaggagttttgcgtaagaactggacagtccaagtcaattgg
ttgatgcaccggctggtacactctggaagttcttga

DBGET integrated database retrieval system