KEGG   Ciona intestinalis (sea squirt): 100180112Help
Entry
100180112         CDS       T01056                                 

Gene name
pik3cg
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
  KO
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Inositol phosphate metabolism
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Module
PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100180112 (pik3cg)
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100180112 (pik3cg)
   04070 Phosphatidylinositol signaling system
    100180112 (pik3cg)
   04150 mTOR signaling pathway
    100180112 (pik3cg)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100180112 (pik3cg)
Enzymes [BR:cin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100180112 (pik3cg)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
8
AA seq 1131 aa AA seqDB search
MSQSPKLSLSVPPDAFDTGSSDGEPFSPLPPEIQRLRNDSDPKSEFRRKKSRIVRQNPIP
KVPVGFFSIIRTMTVDFVLPNEKTVTLNCVGNQTVGQIKSDLLERIRDQYLAYEKVWEHE
LLLTYTIDGKTYEICDMHQTFQTLRVINMWTKTGLKGTLDVRHLTAESNEERLFNLTLGS
LMGVIWGKYGSMVKHNTAVTDDEVYVTRRKLTNVRRRALRSRFPSTYSMEPILDHTTPPT
HVKANFQEDETITVCIYGPSKSSTTMSVGVYDPPSKIMEDFFESLTPARKIAFGIPEEAK
APDYVLKVCGMCDYIWGPHEIMDFVYIRHCVARRREPQLALCVPPNDAEDEVLSVHDPWF
FVDDSTGVTENHQQLTLVGCKKNHTEIVAFSLWDMTRKFRIKVLGVDYLTPENETVGTPD
ELYVEFSLYSGRQRLAEPVRTKPVASNADLRWYTSLEFDILLRNVPKEARLNANIIGIFR
TKSVKVKTGIKSVSSNGDQHVILRWANMQLLNHRSVLCTGRHAFKTWPMSYSEDVSVETH
TGTTAPNDGVESTSSTAEIHFELDSYMHPVVFPNGGWKTSNPEDQAPDPIHGSSDWKKLE
EIIQSDTLTELTLEDKALLKKYRSYCRGRANSLPKVLQAVDAASLDSVVDMHALLNKWPA
LSVEVALELLDSQYEDEKVRSLAVKTLKCLSNTKLHAYLLQLTQVLKFEPYHDSALARFL
LTRALQSKRIGHYFFWFLRSEIENPHVSQRYSILLEAYLRGCGSNMLKEFSKQCAVTNTL
KNFSSLISMKLSKNSNSGLKTEILREQLARISLPETFKAPFDPRITLGRLMAEKSKIMDS
KKKPLWLEFENADENVINESTSVIRIIFKQGDDLRQDMLTLQMLSLMGQLWNEEGLDLHL
LPYGCLSTGLQVGIIQIVPNATTVARIQKESGGLIRGTFKDEVLKKWLERKNPTTDRMNS
AVETFMLSCAGYCVATYVLGIGDRHNDNIMVTESGNLFHIDFGHFLGNTKRFYGIQRERV
PFVLTPDFVHVMGTEDGELFQRFMDTCVLAYLVIRRHAPLFINLFHMMKSTGIPELNSVR
DIRYLQNVLVLDKTEHEASQHFLSEIAGVLRKNWTVQVNWLMHRLVHSGSS
NT seq 3396 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagtctccgaaactaagtctatccgtgccccctgatgcgtttgacactggttcg
tcagacggagaacccttctctccacttcctcctgaaatccagcggcttcggaatgattcg
gatccgaagtctgagtttcggagaaagaaatctcgcatcgtccgccaaaacccaattcct
aaagttccggtcggattcttttctataattcgtacgatgacagttgactttgtacttccg
aatgagaaaactgtcactttaaactgtgtgggcaaccaaactgtcggtcaaatcaagagc
gatttactagaacgaatacgagaccaatatcttgcatacgagaaagtttgggagcatgag
ctgctacttacctacaccattgacggaaaaacttacgaaatctgcgacatgcaccaaaca
tttcagacgttgagagttattaacatgtggacgaaaactggactcaagggaacgttggat
gttcgacacctaacggcagaaagcaacgaagaaagacttttcaacttaaccctcggttcg
cttatgggggtgatttggggtaaatacggatccatggtcaaacataacactgcggttact
gatgatgaggtttacgttacaagaaggaaacttacaaatgttcggcgtcgagctttgagg
tcgaggtttccaagtacttactcaatggaaccaatactcgaccatacaacgccaccaacg
catgtgaaggcgaattttcaagaagacgaaacgataaccgtttgcatatatgggccaagc
aagagcagtacaactatgtcagtaggagtttacgatccaccctcgaaaattatggaggat
ttctttgaaagtcttacaccggcaaggaaaatagcgttcggaattcccgaagaagccaaa
gctccagattacgtgttgaaagtttgcgggatgtgtgattacatatggggacctcacgag
ataatggattttgtttacattcggcactgtgtagctcggagacgcgagccccaacttgct
ctatgtgttccccccaatgacgccgaagacgaagtcttaagcgtgcacgatccgtggttc
tttgtggatgattccactggtgtaaccgagaaccatcaacaactcacgctagtcggctgc
aagaagaaccacacagaaatcgtggcgttttcgctctgggacatgacgcgaaagtttaga
ataaaagttttaggtgtggactaccttacacccgagaacgaaacggttgggacaccggac
gagctttacgttgagttttcgctttacagcggaagacagagattagcggaacctgtacga
actaaaccagttgcttccaacgccgatctaagatggtatacttcattagaattcgacatt
ttgcttcgaaacgttccaaaagaagcaagactgaacgcgaatattattggtattttccgg
acaaagtcggtaaaagtgaaaacgggaatcaagtccgtgtcctcgaacggagatcaacat
gttatactacgatgggctaatatgcaacttttaaatcatagatcagtgttgtgcactggg
cgtcatgctttcaaaacctggcctatgtcgtacagtgaagatgtgtcagttgaaacacac
actggaaccactgctccaaatgacggggtagaatccacaagtagcacggctgaaatacat
tttgagcttgactcttacatgcatcctgtagtcttccctaatggaggatggaagacctca
aacccagaagatcaagctccagacccaatccatggatcctcggattggaagaagttggaa
gagatcattcaatctgatactcttactgaactaacactggaggataaggctcttcttaag
aaatacagatcttactgcagaggaagagccaattcgttgcctaaagttttgcaagcagtt
gatgctgctagtttggatagtgtggttgacatgcacgccttgctgaataagtggccggct
ttatcagtagaggtagcactggagctactggactctcaatatgaagatgagaaagtacgt
agtttggccgtgaaaactctcaagtgtttgagcaacaccaaacttcatgcttaccttctg
cagctaactcaggttttaaaatttgagccatatcatgacagtgctttggcccgttttctc
ctcacgagggcactgcagagcaagagaatcgggcattacttcttctggtttctcagatcg
gagattgaaaaccctcatgtcagtcaacgttattcgatcttgctcgaagcatatctacgt
gggtgtggaagcaacatgctgaaagaattttctaaacagtgcgcggttactaacacgctg
aaaaacttttcttcactaatctcgatgaaattgagcaaaaactccaacagtggcctcaaa
actgaaatattacgagagcagttggcgagaataagccttccagagacttttaaggctcca
tttgatccaaggattactctcgggcgtctaatggcagaaaaatccaaaatcatggattct
aaaaagaaacccttgtggctggaatttgaaaacgctgatgaaaacgttattaatgaatct
actagtgttataagaataatcttcaaacagggtgatgatttacgacaagatatgttgact
ctgcaaatgttgtcgcttatgggtcaactatggaatgaagaaggattagacttgcatctc
ctgccttatggatgtctaagtacaggtcttcaagttggcatcatccagatcgttccgaat
gcaaccactgttgcccgcatccagaaagagtccggaggacttatccgtgggacgttcaaa
gacgaggttctgaagaaatggctggaaagaaagaatccaacgactgacagaatgaattcc
gccgtggagacgttcatgttatcttgtgctggttactgtgtggctacttatgttttaggc
attggagaccggcataatgataatattatggtgacggagtccggcaatttattccatatc
gacttcgggcatttcctcggaaacacaaaaaggttttacggcattcaacgagagcgtgtg
cctttcgttttaaccccagatttcgttcatgttatgggaacagaagatggggaattattc
caacgttttatggatacctgcgtgcttgcatacttagtaatacgcagacacgcacctctt
tttatcaacctctttcacatgatgaagtcaacagggataccagaacttaattcagtcaga
gacattcgctatttacaaaatgttcttgttcttgataagactgaacatgaagcaagtcag
cattttctttcagaaatcgcaggagttttgcgtaagaactggacagtccaagtcaattgg
ttgatgcaccggctggtacactctggaagttcttga

DBGET integrated database retrieval system