KEGG   Ciona intestinalis (sea squirt): 100180252Help
Entry
100180252         CDS       T01056                                 

Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform-like
  KO
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Inositol phosphate metabolism
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Module
PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100180252
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100180252
   04070 Phosphatidylinositol signaling system
    100180252
   04150 mTOR signaling pathway
    100180252
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100180252
Enzymes [BR:cin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100180252
Membrane trafficking [BR:cin04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100180252
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 1043 aa AA seqDB search
MSPSSTHSSASGELWGFPLMPNKVYVDIFLPNGIFISLETSRECGLFELKETVWNMAKEQ
PLYDRLLENNAYVFVGVTKDAETEEFYDEHRRLCDIHLFQPILKLTAAKGNREEKMLKQS
ITQAVGVSIDEFVRRRNPEVDDFRRDVASFCKSEVEARNRCCDPHALIAYCYPPRVEPSP
KLPLHTTENLLSNTNIVIRVWVVQENSFQTHASVCVPCDTTPAMIISEVVKKKVLTFNNS
QSNSTKSINEHYVLKVCGLNEYLEGNFPICQYKYIRQCVNRDELPDVMLESVKQVLAKIP
PHLPYMQPNINKHKNNKESRPPIMSHMLTQNFKFLVNIGIYLNVGENLYVYANLYHGTKP
LCEGKKTVELGGTEAPKWNQWLTFDIKVADIPRCAKLCVAVCGVRRKKDEHWPLAWANIP
LYNYTGKFIQGQHTVRLWHPPCHMDGMLNPIGVTGSNPMKETPCLELEFEGHRANVEFTQ
TNEGLIEGDYTELAFDSPPLDDGGDLKRLMNIVSRDPLSPLTQDERMLLWRCRGLCKEIP
QSLPKLLQSVKWEDRELVKEFYSLLASWPRLPPEYAIELLDCKYPDPKVRRFATECLDVG
LTDDGVLKYLLQLVTAIKFEFYLDNSLVRFLLKRAIKNLRIGHYLFWHLKSEMYDVQVSL
QFGLLLEAYCRSCGPYLAQLVRQTEILTKLKNVNTILQKDDNISQKALKEYLCKPDYQEI
LQNNLSPLNPAYKLENLRNNSCEVKSSAKRPIILQWHSADPLAQYFQPVHGILFKNGDDL
RQDMLTLQVLRVMDEIWQSDDLDLCISPYICISMGHNVGMIEIVQNAETVMNVQKKGGVV
GSLQLRNGTLHQWLKDNNPGEKQYNKAITXFTRSCAGYCVATLLLGIADRHNDNIMIKKN
GQMFHIDFGHFLNHKKKKYGICRNRVPFVLPGDFLRIICRGSTTELSKTYDYKHFEDLCC
RAYLSIRSRANLIINLFCMMLGAGLPELSSFDDIEYIRASLAVEKDETQAVQYFRDCLAA
AQDKQWTTKVDWVCHAVRNSVRK
NT seq 3132 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccttccagtacgcattcgtcagcgtcgggagaactatgggggttcccactcatg
cccaacaaagtttatgtggatattttcctccccaatgggatttttatatcgcttgaaact
tcgagggaatgcgggttgtttgagctcaaggagacggtgtggaacatggcgaaggaacag
ccgttgtacgacagattgttggaaaataacgcttacgtgtttgttggtgtcaccaaggac
gccgagacggaggaattttacgacgaacatcgaaggttgtgcgatatccatcttttccaa
ccaatcttgaagttaactgctgcaaaggggaatcgagaggaaaaaatgttgaaacaatcg
atcacgcaagctgttggggtttccatcgatgagtttgtgcggagaagaaatcctgaagtc
gatgattttcgacgagatgttgcaagtttctgtaaaagtgaggttgaggcgcgcaacagg
tgttgtgacccgcatgcgttgattgcttattgctacccacccagagtggaaccatcacct
aagctgcctctgcacacgaccgagaatctactaagcaatacaaacatagtgatccgtgtg
tgggtggtacaggagaattccttccaaacccacgcatcagtgtgcgtaccatgcgataca
acgcccgccatgatcataagtgaagttgtgaaaaagaaagttttaacttttaacaactcg
caaagtaattcaaccaagtcgataaacgaacattatgttttgaaggtttgtggcttaaat
gaatatctggaaggaaatttcccaatttgtcaatataagtatatccgtcaatgtgtaaat
cgtgatgagctgcccgatgttatgttggagtcggtgaagcaagtattggcgaaaattcct
ccccacctgccatatatgcaacctaacattaataaacataaaaacaacaaagaatcacgt
cctcccatcatgtcccatatgttgacgcaaaactttaagtttctcgtgaacattggaatt
tatctgaacgttggtgaaaatttgtacgtttacgcaaatctttaccacggaactaaacct
ttatgcgagggtaagaagacggtggagttgggggggacggaggcgcccaagtggaaccag
tggcttacgtttgatattaaagttgccgatataccgcgatgcgctaaactatgtgttgct
gtgtgtggggtgcgtaggaagaaggatgaacattggccgttagcgtgggcgaatatacct
ttgtataattacactggtaagttcatacaaggccaacatacagtaaggttatggcatcca
ccctgccatatggatgggatgcttaaccctattggtgtcaccggttcaaaccctatgaaa
gaaaccccatgtttagaactagagtttgaggggcatcgagcaaacgtggaattcacgcaa
accaacgaggggttgattgagggagattatacagagcttgcgtttgattcaccccccctt
gatgatgggggtgatttgaagaggttgatgaacatcgtttcacgcgacccactttccccc
ctcacccaggacgaacgtatgttgctatggagatgtaggggactttgcaaggaaatccca
caatcgttacccaagttgttacagtctgtaaaatgggaggatcgggagttggtgaaagag
ttttactcgttgctcgcttcgtggccacgtctgccaccggagtacgctatcgagttgttg
gattgcaaatatcccgaccccaaagttcgaaggtttgccaccgagtgtctagatgttgga
ttgacggacgacggggtgttgaagtatcttctacagcttgttacggcgatcaagtttgag
ttttacctcgacaactcactggttcgtttcttactgaagcgagccattaaaaatcttagg
attggacattatttattctggcatttgaaatctgagatgtacgacgtacaagtatcgcta
cagtttggcttgctacttgaggcttactgtagatcatgtggtccgtatctcgcacaactg
gtgaggcagacagagattctcaccaagctgaaaaatgtcaacaccatcttacaaaaagat
gacaatatttcacaaaaagcactcaaggaatatttgtgtaaacctgattatcaagaaatc
cttcaaaacaaccttagcccactcaacccagcctacaagttggaaaatcttcgaaataat
tcatgtgaagtcaaatcatcagcgaagcggccgataatcttacagtggcacagcgcggat
ccacttgctcaatatttccaacctgtacacgggatattgttcaagaatggagatgattta
cggcaagatatgctgacattacaagtactaagggtaatggatgagatttggcagagtgat
gatttagatttgtgtatatcgccatatatatgcatatctatgggacataatgttggcatg
attgagatcgtacaaaacgctgaaactgtaatgaatgtgcagaagaagggaggggtggtt
ggatcgttgcaactaaggaacggaacgttacatcaatggttgaaggataacaaccctggt
gagaagcaatataacaaagctattacanacttcactcggtcatgtgccgggtactgtgtt
gctacattgctcttgggtattgctgatagacataatgataatattatgataaagaagaac
ggacaaatgtttcacatcgactttggacatttcttgaaccataagaagaagaaatacggg
atttgtagaaaccgtgtcccattcgttttacccggtgacttcctaagaataatttgtcga
ggttccacaacagagctatcgaaaacttacgactacaaacactttgaggatctttgctgc
cgtgcttatttatcgattcgatcgcgcgcaaacttgattatcaatttgttctgcatgatg
ttgggtgcagggttgccagaactttcctcgttcgatgacatcgaatacattcgtgcgtcg
cttgctgtggagaaagatgaaacgcaagccgtccaatattttcgagattgtttggccgca
gcacaagataaacaatggacaaccaaagtcgattgggtttgccacgctgtacgtaacagt
gtgcgaaagtaa

DBGET integrated database retrieval system