KEGG   Ciona intestinalis (sea squirt): 100180401Help
Entry
100180401         CDS       T01056                                 

Definition
histone-lysine N-methyltransferase EHMT1-like
Orthology
K11420  
euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:cin00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
9
AA seq 474 aa AA seqDB search
MPCIHHAAKEGYVEGCYLLMIYGRAKINSLDEGGWTPLVWAAEHKHTSMAKFLLHYGADV
KIIDKEGNTCLLWAALSGNVDILKMCLDNNTPVDHFNTHGDTALHIAARQDNYNCVFTLL
ANAANPNIKNSEGETPIECAPERSMCWIALKIHLCIRNAGLFRKVILPYNRERVLNPDIS
RGYDKLPIICVNARDDAPCPTNPPHGFHYVTENVHTSQDTRINVVISGMQSCQCSDNCGS
PSCVCGLISERCWYGNDGTLLPEFDILEPPLIYECNQMCRCSRQCKNRVVQNGIRYRLQV
YRTQGMGWGLVALEAMPRGAFVCEYVGELISDDEADQREDDSYLFDLENKDGEIYCIDAR
NYGNVSRFINHLCEPNLIPIRVFVGHHDIRFPILAYFTTREIQAGEELGFDYGERFWDVK
CRQFTCQCGSPVCKYSSEVYKNKAEQELQQHNENNDVTNDVEMKASSANNEIVD
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgccttgcattcaccatgcggccaaggaaggctacgttgaaggttgctaccttctaatg
atatatggcagagcaaaaatcaattcactcgacgaagggggatggacaccgctggtttgg
gcggcagagcataaacatacaagcatggctaagtttcttctgcattatggagcagatgtg
aaaattattgataaggagggaaacacatgtttgctgtgggccgctttatctggaaacgtc
gatatattgaaaatgtgtttggacaacaatacccccgttgatcattttaacacacatggt
gacactgcattacacatagcggcaagacaggataactacaactgtgtttttactcttctc
gcgaatgctgcgaatccaaatatcaagaacagcgaaggggaaactcccattgaatgtgca
ccggagcgtagcatgtgttggattgcgttaaagatccatctgtgcattcgaaacgctgga
ttgtttcgaaaagtaattcttccttacaaccgagagcgagttttgaacccggatatctct
cgtggatatgacaagctgccaataatatgtgtgaatgcacgtgatgatgcgccttgtccc
accaaccccccacatggttttcattatgttactgagaacgttcacacttcacaagataca
agaattaatgttgttatatcaggaatgcagtcatgtcagtgcagcgacaactgtgggtct
ccatcttgtgtgtgtggcttgataagcgagaggtgctggtatggtaacgatgggactttg
ctgcccgagtttgatattcttgaacctccacttatctatgaatgcaatcaaatgtgcaga
tgttcgcgacagtgtaaaaacagagtggtacagaatggaataaggtatcgcctacaagtt
tatcgaacccaaggcatgggttgggggcttgttgcgcttgaagcgatgccacgtggtgcg
tttgtatgcgaatatgtgggtgaactgatctcggatgatgaagctgatcaacgggaagat
gattcgtatttgtttgatttggaaaacaaggatggtgaaatatattgcattgatgctcgt
aactacggcaacgtgtcgcgcttcatcaaccacctttgtgaaccaaacttaatcccgatc
cgagtatttgtcggacatcacgatataaggtttcccatccttgcttactttaccactcgt
gaaatacaagctggggaagaacttgggtttgattacggagagcgtttctgggacgttaaa
tgtcgtcagttcacctgccaatgcggatcaccagtatgtaaatattcaagtgaagtttat
aagaataaagccgaacaagagctacaacaacataatgaaaataatgacgtcacaaacgac
gtggaaatgaaagcttcatcagcgaacaacgaaatcgtggattaa

DBGET integrated database retrieval system