KEGG   Ciona intestinalis (sea squirt): 100180537Help
Entry
100180537         CDS       T01056                                 

Definition
histone deacetylase 11
Orthology
K11418  
histone deacetylase 11 [EC:3.5.1.98]
Organism
cin  Ciona intestinalis (sea squirt)
Brite
Enzymes [BR:cin01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100180537
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 344 aa AA seqDB search
MEQQENEATETEQQDPAFAISQLYNVESDVTKWPLVYHQSYNISFLGLEALHPFDSGKWG
KVYQFLIDDKLLQNNQHFQPLEPTERDLLIAHSKEYLSSLKWSANVARITEVPPVALLPN
FIVQRKVLLPLRLQTGGSVLAGKLAIERGWAINIGGGFHHCSGDRGGGFCAYADITLLIK
FVFAKFDAIKRVMVVDLDAHQGNGYARDFMFDDRVFVMDVYNRNIYPHDGYAKRGIKRKV
ELTSGVDDQTYLPLVKSHLTESIGEFNPQLIVYNAGTDILQGDQLGRLNISAEGIVKRDE
IVFALAKGRGIPIVMLTSGGYQRTTARIIANSILSLRNNGLIDL
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggaacagcaggaaaacgaagcaactgaaacagagcagcaagatcccgcttttgcaatc
tctcaactgtataatgtggaatctgatgtaacaaaatggcctttggtttatcaccaaagc
tacaatatttcatttcttggtttggaggcactacacccgtttgattccggaaaatgggga
aaagtttatcaatttctcatagatgacaagttacttcaaaacaaccaacattttcaacca
ttggagccaacagagcgtgatctactgattgcgcattcaaaggaatatctaagcagctta
aagtggagcgccaatgtggcgagaataactgaagtcccacctgtggctttgcttccaaac
ttcattgtgcaacgaaaagtgcttcttccccttcgtctacaaactggtggcagtgtcctt
gctgggaaacttgcaatagaaagagggtgggcaatcaacattggtggagggttccaccat
tgctctggtgaccggggtggcggcttctgtgcctatgcagacatcactttattaataaag
tttgtttttgcgaaatttgatgccatcaagcgagttatggtggttgacctagacgcacac
cagggaaatggttacgcccgagatttcatgttcgacgatcgtgtgtttgtaatggatgtt
tataatcgcaatatctatcctcatgacggttatgctaagcgaggaattaaaaggaaagtc
gaacttacaagtggagttgatgatcagacctatctccctcttgtaaaatcccatttaacc
gaatctatcggtgaatttaatccacaactcattgtgtacaatgcagggactgatattttg
caaggagaccaactcggacgtcttaatatatcagcagagggtattgtgaaacgtgatgag
atagtatttgcattagccaaaggaagaggaattcccatagtaatgcttacttcaggagga
taccaacgaacaacagcaaggataatcgcaaactcaatcttatcattaagaaataatggt
ctgattgatctgtga

DBGET integrated database retrieval system