KEGG   Ciona intestinalis (sea squirt): 100180543Help
Entry
100180543         CDS       T01056                                 

Definition
agmatinase, mitochondrial-like
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    100180543
Enzymes [BR:cin01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     100180543
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 342 aa AA seqDB search
MLFPRSYIFARVAKQHCKTISNRNYVTKKFNTPLSGMEMARCGGIASMMRLPIASSTEGL
DACFVGVPIDHGTSNRPGTRFGPREIRSSSVVVHEVNVTTGATPFQSLMVADVGDVWVNL
YNLPDTCRSIKESFAKMIANGCIPLTAGGDHTITYPILQAIAGKYGPVGLVHVDAHGDCS
DTMLGEKIAHGTPFRRAVEEGLLDTKRVVQIGLRGSGYSVDDNKYQLDNGFRVVPAEQCW
HKSLSPLMNEVKEQMGDGPVYISFDIDALDPAFAPGTGTPEIGGLTSIQGLEVVRGCRGM
NVVGADLVEVSPPYDTTGITALTGANLLFEMLCILPGVKYDK
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgttgtttcctcgaagctatatatttgctcgtgttgcgaaacagcattgtaaaacaata
tcaaacagaaattatgttaccaaaaaatttaacacccctttaagtggaatggaaatggct
cgctgtggaggtattgcaagtatgatgcgacttccaatagcttcgtcaacagaaggactg
gatgcttgttttgttggtgttcctattgaccatggtacttcaaatagacccggaactaga
tttggcccgagagaaatccgatcttcttctgtggtagtgcatgaagttaatgttacaact
ggtgccacaccatttcaatcactcatggttgctgacgtaggagatgtatgggttaatcta
tacaacttaccagatacatgcagaagtattaaagaaagttttgccaaaatgattgcaaat
ggttgcattccattaactgcaggtggagatcacaccataacatatcctattctacaagca
atagctggcaagtatgggcctgtgggtttggttcacgttgatgcacatggcgactgcagc
gacacaatgcttggtgaaaaaattgctcatggaacaccatttagacgagctgtagaagaa
ggcttacttgacactaagcgagtggtgcagataggcctgcgtggttctggttactcagtt
gatgataataagtaccagttagacaacggtttccgagtggttccagctgagcaatgctgg
cataagtctctctccccattgatgaatgaagtgaaagaacaaatgggagatggaccagtg
tatataagctttgacattgatgcgttagacccagcatttgctcctggaactggaacccct
gaaatcggtggactcacttctattcagggacttgaggtcgtaaggggttgtcgtggaatg
aatgtggttggagctgaccttgtggaagtatcgccaccttatgatacaacaggaataacc
gctcttactggtgcaaatcttctgttcgagatgttgtgcattctaccgggtgtgaaatat
gacaaataa

DBGET integrated database retrieval system