KEGG   Ciona intestinalis (sea squirt): 100180551Help
Entry
100180551         CDS       T01056                                 

Definition
inositol monophosphatase 1-like
Orthology
K01092  
myo-inositol-1(or 4)-monophosphatase [EC:3.1.3.25]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, Ins(1,3,4,5)P4 => Ins(1,3,4)P3 => myo-inositol
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100180551
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    100180551
Enzymes [BR:cin01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.25  inositol-phosphate phosphatase
     100180551
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2
AA seq 275 aa AA seqDB search
MAAVNLEEILTFGTGLARTVGSVILDAFKQPKNIQHKMGCADLVTETDQQVEEMIIKAIK
ETYPSHKFIGEESVAGGLKCNLTDDPTWIVDPIDGTTNFVHRYPYVAVCLGFCVNKTVKL
GIVYNVPNDEMFTAIRGQGAFSNGKKLAVSSESDLSKSLIMAEFGSARDPATVETVLKNM
SSVVLNPVHSIHCMGSAALNICAVASAQAEAYYEFGIHCWDYCAASIILEEAGGVTIDTE
GGPMDLMARRIVAACNLTIAEGLRKKLVPIHFPRD
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgttaatttagaagaaattcttacttttggaacaggactggcaaggactgta
ggatcagttatcctggatgcatttaaacaaccaaaaaacattcaacacaaaatgggttgt
gctgatttagttaccgaaactgatcagcaagttgaagagatgataataaaagcaattaag
gaaacttacccttcacataagttcattggtgaggaatctgttgctggtggtttgaagtgt
aacctcacagatgatccaacctggatagttgatcctattgatggaacaactaattttgtc
catcgatatccttatgttgccgtctgtcttgggttttgtgtgaacaaaacagtaaaactt
ggaattgtatacaatgtcccaaatgatgaaatgtttacagccataaggggccaaggagca
tttagtaacgggaaaaagctggctgtgtcaagcgaaagtgatctttccaagtctcttatt
atggcagagtttggttcagctagggatcctgctacagtggaaactgtgcttaaaaacatg
tcatcagttgttctaaaccctgttcattccattcactgtatgggttcagcagctctaaac
atttgtgcagtggcttctgcacaggctgaagcttattatgaatttggtatccactgttgg
gattattgtgctgcgtcgatcatattggaagaggctggtggtgtgaccatcgacacagaa
ggaggtccaatggatttaatggctcgacgaatagttgctgcatgtaatttaactattgca
gaaggtttaagaaaaaagttggttccaattcattttccaagagactga

DBGET integrated database retrieval system