KEGG   Ciona intestinalis (sea squirt): 100180572Help
Entry
100180572         CDS       T01056                                 

Definition
nuclear pore complex protein Nup205-like
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:cin00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100180572
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 975 aa AA seqDB search
MELNNWSPFKDLFTASQDFALRNSQASTHLLRSLLRKHKPELLSLLKNSPQNATHREKLK
NSHSVGLVINENESPKVFEQTFIDEAIIISDMFKLNELAAVDLLLTGEQQTPNYPNYSRG
LVAVLLYWDGRRNLASSLRTLVQCRRGATWTLDISPEGTSMVTSFSDELLSNGMTQQILK
LLREIKVEAEMEKLASQRGLGDSKHRKQVRDLITEVRQCLAETLFYFAGQSRLPLNDITA
MIHYLETDGEVESDGKLSLPTLAVLFAVLYAISLPYDLNTIQDESTVEELLQHPLITDAS
YLSGIHKVLAKESNHPSSWKVSGVRSCLQLAWSVTLRLLAQIPSSLLSGITPPSGEILEQ
DELVVEMALADRVFLFIKENIVLCPSFHSEEFYLRRIHGIITDLIVNMTLKVKEMRNHGD
EVARILMLHLAQGEEPPPSLRKDFHQLLELITALYEDDPLSLELCSEYWCTADTSMMDAG
SYIISPHRFHHGPPQRQTALFKFVRQSGDLLPPLLYVPYLHMLSALASGTQSARACYEML
HYNGANFSGGSDVNSMSLDHFFSSCHRYYEHLHQDKPLHDITNPFMMSQSQFGSQSGHPP
RNRSITPKEVEGLRAVMKLLTQIIKYDNIACINIYENQQWLACGVLYGLLQCPVPVTLKG
DVLGVLTQLSRIPEIASGILQITESAQILVTTGDCSPGSSGVSLELEQIESREEEYPMTR
SFVNLLTAMAHSGANLSVIGEGVRAPGFDPYLTFTVESVFLKFSTRAYGRKEEKWEVASS
CLKLFNKLITTYQPHPDHFNVNKTGLPADVMLDRTQLMHDAGPFSKIRPPAFHLLLYVYN
QGNFFKTDPGILGSSRSCLHSVLTILSLESSIETADGTTTTQPLSIIETPKLSELCYQLV
HKLAANVDTSGPVLRCREVERSFDAASMVIKDSCYRVIFTLVETTTCECREDTEGTVFFR
FMQSDWLNFKRIAFA
NT seq 2928 nt NT seq  +upstreamnt  +downstreamnt
atggagttaaataactggagtccattcaaggacttgtttacagcaagtcaggactttgct
ttgcgtaactcacaagcttcaacccatctgctaagatccttactaagaaagcataaacct
gagctgctatccttgctgaaaaactcgcctcaaaatgccacccatcgagaaaagctaaaa
aacagccactcagtggggctagtgatcaacgagaatgaatctcccaaagtttttgagcaa
acctttatcgacgaagcaataattatcagtgatatgtttaaactaaatgaattggctgct
gtggatttgttattaacaggagagcaacaaacgccaaactatcctaattattcccgtggt
ctagttgctgttctcttgtactgggatggccgtcgtaaccttgcaagctcacttcggaca
ttagttcagtgtcgtcgtggtgcaacatggaccttggatatctcccctgaaggcacatct
atggtaacttcattttctgacgagttgctaagcaacggtatgactcagcaaattttgaaa
ctactccgtgaaataaaagtggaagctgagatggaaaagttggcgagtcaacgtggtttg
ggtgattcaaaacatagaaagcaggtgcgcgatttgatcactgaagttcggcaatgctta
gctgaaaccctcttctactttgctggccaatcaaggttgccactcaatgatataactgcg
atgatacattaccttgaaacagatggggaggtagaatcagatgggaagctctctctcccc
actcttgctgtgctgtttgctgttctttatgctatttcactcccctatgatttgaataca
atccaagatgaaagcactgttgaggaacttcttcaacatccactgataaccgatgcatca
tatttatccggtattcacaaagtgctggccaaagaaagcaatcacccaagttcttggaaa
gtatcgggtgttcggtcatgcttgcagttagcatggtcggtcacgcttcgattgctcgct
caaattccctcctcgctgctcagtggcattaccccaccaagtggtgaaatacttgagcaa
gacgaactggtcgtggagatggctctcgctgatcgtgtgttcttgtttataaaggaaaac
attgtgttatgcccgagtttccactcagaagaattttatcttcgtagaatccatggcatc
ataactgatcttattgttaatatgacacttaaggtaaaggagatgcgtaaccatggtgac
gaggtggcgaggatactcatgctccacctggcacaaggtgaagaacctccaccttcgtta
aggaaagatttccaccagttgttggaactgatcactgcgttgtatgaagatgatccttta
tcacttgaattatgctccgagtactggtgcacagcagacacatctatgatggatgcgggc
tcctacatcatctcccctcatcgatttcatcatggtcctcctcagagacaaactgctttg
tttaagttcgtccgccagtcaggagatctcttgccccccttactatatgttccatacctt
catatgttatctgcattggccagtggaacacaaagtgcccgtgcatgttatgagatgcta
cattacaatggtgcaaacttcagtggtggtagtgatgtaaattcaatgtcacttgatcac
ttcttctcatcttgtcatcgatattatgaacatctacatcaggataaaccactccatgac
atcacaaacccatttatgatgtcacagtctcaatttggatctcagagtgggcaccctcct
cgaaacagaagcatcacacccaaagaagtggaaggattgagagctgtcatgaagttgctt
acacagatcattaaatacgacaacattgcatgcatcaacatatatgagaaccaacagtgg
ttagcatgcggggtgttgtatgggttgctacaatgcccagtgcctgtcacactgaagggc
gatgtactgggagtcctcactcagctctcgaggatcccagagatcgcatccggcatcctc
cagatcactgagagcgctcaaatcctcgtcactactggagattgctcacctggttcatca
ggtgtatcactagagttggagcagatagaatcacgtgaagaggaatacccgatgacgcgt
tcatttgtgaaccttctcacagccatggctcactctggtgctaatctatcagtcattggt
gagggtgtgcgagctcctggatttgatccatacctcacgttcactgtcgagtcggtcttt
ctcaagttttcaacgcgagcctatggaagaaaggaagaaaaatgggaggttgcatcatct
tgcctcaaattattcaacaagttgatcacgacctatcaacctcaccctgatcatttcaac
gtcaacaaaactggtttgccggctgacgtcatgctcgaccgcacacagctgatgcacgac
gccgggccgttttcaaagatccgaccaccagcgtttcatcttttactttatgtttacaac
cagggaaactttttcaaaaccgatccaggaatcctcggctcttcccgctcctgcctccac
tctgtgctcactattctctcactagagagcagtatagagacagcagatggcaccaccacc
acacaaccacttagtatcattgaaacaccgaagctgtcagaactctgctatcagcttgta
cataaacttgcagcaaatgtggacacgtctggacctgtcctcagatgtagagaagtcgaa
agaagttttgatgcagcaagcatggttattaaggacagttgctatcgagttatattcact
ctcgttgaaacgacaacgtgtgaatgcagagaggatactgaaggtactgttttcttccga
ttcatgcaatctgattggctcaactttaaacgcatcgcgtttgcttaa

DBGET integrated database retrieval system