KEGG   Ciona intestinalis (sea squirt): 100180579Help
Entry
100180579         CDS       T01056                                 

Definition
aldose 1-epimerase-like
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cin00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cin00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
11
AA seq 349 aa AA seqDB search
MGHVKCSEFGKTKNGQVVNLYELKSNHVELGLINYGATIAYLKVPDRFGKRDDIVTGFDN
LEDYLSCKNYFGCVVGRVANRIGEGKFHLNGQEWVVDVNNGPNCNHGGSAGFDTKVWECT
SAENNSVTFRLESPHGDMGFPGDVVVTVTYILHNNELEIKYKGTSNQPTPMNLTNHANFN
LGGHSKWENFCDHFLNIPADHYLPTDEHCLVTGDMAPSEKTDFNLKNEPRKLTQDFLLNL
PGGGYDHNFCLTRDKTKKLAAVLTHAGTSRVLKVYTDQPGIQVYTGNFLNGMKGKQGVKY
TKHSAICLETQNWPNAINNPNFPDSICTPDTPYSHNAWFEFATGSCDLE
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgggtcatgtaaaatgtagtgagtttggaaagactaaaaatggtcaagtcgtaaatttg
tatgaattaaaatccaatcatgttgagttgggcctgatcaactatggggctactattgct
tatctgaaggttccagacaggtttggaaaaagggatgacatagtcactggattcgataat
ttagaggattatctttcgtgcaaaaactattttggatgcgtagtaggacgcgtggcaaac
agaataggtgaaggaaaattccacctcaatggccaagaatgggttgtggatgttaataat
ggtccaaactgtaaccatgggggctcagcgggattcgatacaaaagtatgggagtgtaca
tcagcagaaaataactctgttaccttcaggctcgaaagtcctcatggtgacatggggttt
cctggagatgtggttgtcactgtaacttacatacttcataacaatgaactagaaataaaa
tacaaaggaacctcaaaccaaccaacaccaatgaatttgaccaaccatgctaattttaat
cttggagggcatagcaagtgggaaaatttttgtgaccatttccttaatattccggccgat
cattatttaccaacagatgaacattgcctcgttacaggtgatatggcacccagtgaaaaa
acagattttaatctcaaaaacgaaccaagaaaactcactcaagattttttgcttaatctt
cctggtggtggatatgatcataacttctgtttaacaagagacaaaaccaaaaaactggct
gctgttttaacccatgctgggactagtcgtgtgctgaaggtgtatacagaccaacctggt
attcaagtttatactggcaactttctcaatggaatgaaaggaaaacaaggtgttaaatat
accaagcattcagctatctgcttggagactcagaattggcctaatgcaataaacaaccca
aattttcctgattcgatctgcaccccagacacaccatacagccataatgcatggttcgag
tttgctactggaagttgtgacttagagtag

DBGET integrated database retrieval system