KEGG   Ciona intestinalis (sea squirt): 100180643Help
Entry
100180643         CDS       T01056                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase CYLD
  KO
K08601  
ubiquitin thioesterase CYLD [EC:3.4.19.12]
Organism
cin  Ciona intestinalis (sea squirt)
Brite
Enzymes [BR:cin01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100180643
Peptidases [BR:cin01002]
 Cysteine Peptidases
  Family C67
   100180643
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
14
AA seq 988 aa AA seqDB search
MAERYSRDMIPTRYLILVNDLCFTKKNVPYRPKKFESHIQEYLKGTILQEVFFASMPTTN
TTRITCIVLDTREIIECDENDVDALTEEIMGLLMAISSCKERYDVFRNKERLADGLDMEA
GAEVVVRLPAMSGEVLGRLRYKGKVHHKVGTYFGVELINAKGKGNTNGTIRKHHYFSCPE
DCGIFLGLNRVSSRDYDQLRTPIPAPRRHPRSQRSMISNSYSDLSATRDYSSPPSGSSQV
SVCEPVIGVSEAELSTLNIHIDMKVYIFTEVNGHESQELGSVKFIGRLPNELPTNDIYVG
IELVNPSGNGRGVFNRRQLFKTKLNHAALVPLSGVLPASTIDHTPPLAPNRHLDESLTYI
DKRYKPETRNQQPPSSYSGPAANLRSSTTKNRKVVSQPVLNSEQRGFPDGYDELSSQLDI
YGVEKQVKPRREVHTLPLPKNSKQNNHRQMNDYSRRPFQSEPISVPVQEQAFQYLSQLHP
PADEIPISGFEHGTMVQVLDGIDNLTLLVPDLPLYGVVKWTGYLPRDEDLSVGLELDNPV
PTLTDGTYNGVRIFETQPGHALFVRPEDCAVDPRFYSDAKQSHSNMQSVASRNFGDFKAP
CIPGTVAPPKTLQANMVGKGKGIQGHQNSCYLDSTLFSMFAYSYCLDTILFRSKRPGDLP
QYEQVQKVLKENIVNPLRKTNFVRADMIMKLRELLDELGSVSGLTNEEKDPEEFLQTLLN
HVFKAEPLFELRQGNDDHIQECYFYQIFLDKDEKMVLPSTQLLIEQSFLACDLKFREVPV
CLILQMPRFGKDYKMYNRVRPSLTLDITDMLEKIPRSCTVCGGLAEFECKQCSVERSMQE
HISSYCVQCAKRCHQHPLRRQHNYQKIEVCDEYKSFISQEGEAPVERQILDLYAVVCIET
SHYVSFAKCGSGRNAKWCFFDSMADRVGEQSGYNIPEITYCENFEKWLETDQHKLLEMEQ
KEMPEHMRRLLCDAYMCLYQSSEMKRFG
NT seq 2967 nt NT seq  +upstreamnt  +downstreamnt
atggcggagagatacagcagagacatgattcccactcggtatttaatactggttaacgac
ctttgctttacaaagaagaacgtcccatacagaccaaagaaatttgagtctcatatacaa
gaatatctaaaaggcaccatcctacaagaagttttctttgcttccatgccaaccaccaac
accacaaggataacttgtatagttctcgatacaagagaaataattgaatgtgatgagaac
gatgtggacgctttaactgaagagataatgggattattaatggccatctcaagttgcaag
gagagatatgacgttttccgaaataaagaaagattagcagatggtttagacatggaagct
ggagcagaggttgttgtacgactacctgccatgtcaggggaagttttaggcagactacgc
tacaaaggcaaagtccatcataaagttggaacttactttggtgttgagcttattaatgcg
aaaggaaaaggaaacacaaacggaaccatccgtaaacaccattacttctcatgtccggag
gactgcggtatcttcctcggattaaaccgagtctcctcccgtgattatgatcagcttcgt
actcccatcccggctcctagaagacacccacgtagccagcgatctatgatctcaaactcg
tactctgatctttcagcaacgcgagattacagttcgcctccttcaggtagtagccaagta
agtgtatgcgaacctgtaattggagttagtgaagctgaactctccactttaaacattcat
atcgatatgaaggtttatattttcactgaagtaaacggacatgaaagccaggagctgggg
agcgtcaaatttatcggtcgcctaccaaacgaattacctacaaatgacatttatgttggt
attgaacttgtcaacccatccggtaatggaaggggagttttcaacagacgccaacttttc
aaaacaaaactcaaccatgcagctctagtgccgcttagtggtgtattaccagcgagtacg
attgaccacactccacctctcgctcctaaccgacatttggatgagtcacttacatacata
gacaaacggtataaaccagaaactcggaaccaacagcctcccagctcctattcaggtcct
gcggcaaacttgagaagcagcacaactaaaaatcgaaaggttgtttcacagcccgtactg
aattctgagcagagaggttttcctgatggatatgatgaactgtcatcacaacttgatatc
tatggggtggaaaaacaagtcaaaccaagacgagaagtgcatactctgccactgcccaag
aattccaaacaaaacaaccacaggcaaatgaatgattattctcgaaggccatttcaaagc
gaacccatttcagttccggttcaagaacaagcgtttcaatatttaagccaacttcatcct
cctgcagacgaaatcccaatcagtggttttgagcacggtaccatggtccaagtattggat
ggaatcgataacctcacgttgctggtccccgatttgcccttatatggagtggtaaagtgg
acggggtatcttccaagagatgaagacttgagtgtcgggttagaacttgacaaccctgtt
ccaactttaactgatggaacttacaatggtgtgaggatattcgaaacacaacctggacat
gctttgttcgtacgaccagaagattgtgctgtagatccacgattttactcagatgcaaaa
cagtcacacagtaatatgcaaagtgttgccagcagaaactttggtgacttcaaagcccca
tgtattcctggtacagtagctccaccaaaaacattacaagccaatatggtggggaaaggc
aaaggaatacaggggcatcagaattcttgttatctagacagtacgttgtttagtatgttc
gcgtattcctactgtcttgatacgattttgtttcgaagcaagcgacccggtgatttgccg
cagtacgagcaagtacaaaaggtgctgaaagaaaatattgtcaacccactgcgtaaaaca
aactttgttcgtgctgacatgataatgaaattacgagagttattggatgagttaggctcc
gtgtcagggctaactaatgaagaaaaggatccagaagaatttttacaaactttactaaac
catgtgtttaaagctgaacctttatttgagttacgacaaggcaacgacgaccacatacag
gaatgttatttttatcaaatatttctcgacaaagatgagaaaatggtgttacccagcacc
cagctacttatcgaacaatcttttcttgcttgtgatcttaaatttcgcgaagtacccgtt
tgtttaattctacaaatgccaagatttggtaaagattacaaaatgtacaatcgtgtgcga
cctagtctaacactcgatattactgatatgttggaaaaaattccccggagttgtacagtg
tgtggggggttggctgagtttgaatgtaagcaatgttcagttgaaaggtcaatgcaagaa
catataagttcatattgtgttcaatgtgctaagagatgtcatcaacaccccttgaggaga
caacataattatcaaaagattgaagtctgtgatgaatacaaatcgtttatctcgcaagaa
ggggaagccccagttgaaagacaaatcttggatctatatgcagttgtatgtattgaaaca
agtcattatgtttcatttgccaaatgtggcagcggtcgtaacgcaaagtggtgtttcttt
gacagtatggctgacagagttggtgaacaaagtggttacaatataccagagattacttat
tgtgaaaattttgaaaaatggttggaaactgaccaacataaattactcgagatggaacaa
aaagaaatgcccgaacatatgaggagactgctatgtgatgcttatatgtgtttatatcaa
agcagtgaaatgaaaagattcggttaa

DBGET integrated database retrieval system