KEGG   Ciona intestinalis (sea squirt): 100180654Help
Entry
100180654         CDS       T01056                                 

Definition
general transcription factor 3C polypeptide 4-like
Orthology
K11310  
general transcription factor 3C polypeptide 4 [EC:2.3.1.48]
Organism
cin  Ciona intestinalis (sea squirt)
Brite
Enzymes [BR:cin01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100180654
Transcription machinery [BR:cin03021]
 Eukaryotic type
  RNA polymerase III system
   Basal transcription factors
    TFIIIC
     100180654
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
7
AA seq 729 aa AA seqDB search
MEVTPDSWSATFGESKLENRVVSHHVVDWSDCYTVAVATGRSVVIYSMGLYSESQKLETS
FSVENIPRKANVVKHDVGIESYLSEFESLCNQSSNVAAYPDYSIYKIQLDPLLSQATDST
YNEYDMVRFSPRMSTKFTNHCFLATLTLDNRCAILYKVSTGAETEWKEIICPSEQLHAYL
NENKRYFPGFKMDSTLTKLEKLIEQKYAASIACMDWSDVYTRFDANDETKEVYFATSTRA
GFVVIWRCVVPDFEKPNLNIVYVFQCSYRDIAEIKWCRYAERNRTKTSDNCSLCISSLQG
QISVCRFKIKDDSITLKLEREIWGEKDNLIARHFQFIDIEVGCSMLLAAKSQILIAMKLN
ANLEVCAQVTNLDAHIMPITGMSVVKHGTTHGWYTCSGDGTMVKLDVVLDDENIKLNKEI
LGTSSDIGAYKSISPSMMHGIAVSPNAAFIAVVTSKPIIISSIQVNNVAFLSFKRNSTPY
NAAVTLQSAAFEQNSLNVCYHFLDVIEIIRQHYFVNQNLETVLEEFLTIAPNNYQDETVK
LQLRWHLLQIKYSYINSCQTPSPYRQNENTDPNTKLLEEKIKEVELLLIVSQMLKVIKLW
CENGVPLDSMVPVVQLVKWLESNKSKLSLQSRNVIYQAKSLPAYLMLPTCPVCLITGQDL
ALCLDGLTFFSEDGSRWPACCITFSPLQTYKKRKSSCSSLFGKKCEINDPEWIKELLSME
CLFSGTPLI
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atggaagtaacacccgactcatggtcagcaacatttggggaatccaagctggaaaaccga
gttgtcagtcaccatgtagtagactggtccgattgttacactgttgctgtggcaactgga
aggagtgttgttatttactcgatgggtttgtattctgaaagtcagaaattggagacaagt
ttttcggttgaaaatattccaagaaaggcaaacgttgtgaaacatgatgttgggattgaa
agttatttaagtgaatttgaatcgctgtgcaaccaatcttctaatgttgctgcatatcct
gattactcaatatataagattcaacttgatcctttgctcagccaagcaacagatagcacg
tacaatgaatacgacatggttagattttccccaagaatgtccacaaagttcaccaatcat
tgcttccttgccaccctcacgcttgataacaggtgtgcgattctatacaaagtttccact
ggtgctgaaacagaatggaaagaaataatttgtccatcggaacagcttcatgcctattta
aatgaaaacaagcggtattttcctggctttaaaatggattctactttaacaaagttggaa
aaactgatagagcaaaaatatgctgcttcaattgcttgcatggactggtctgatgtgtac
accaggtttgatgctaatgatgaaaccaaggaagtttattttgcgacatcaaccagagct
ggctttgttgttatatggagatgtgttgtgcctgattttgaaaaaccaaacttgaacatt
gtttatgtctttcagtgtagctatcgtgatattgcagaaataaagtggtgccgttatgca
gagagaaatagaaccaaaacgagtgacaactgctcattatgtatttcttcattgcaaggc
caaatatctgtatgtcgatttaaaattaaggacgacagtataactttgaagttggaacgg
gaaatttggggcgaaaaagacaatctaatagctaggcacttccagtttatagacattgag
gttgggtgttcaatgttacttgctgccaaatcccagattctcattgccatgaaacttaat
gctaatttagaagtttgtgctcaagtaactaaccttgatgcacacatcatgccaataaca
ggcatgtctgttgtaaaacatggcacaacccacggctggtatacatgcagtggtgatggt
actatggtcaagttagatgtggttttggatgatgagaatattaagttaaataaggaaatc
ttaggcacttcatctgacatcggtgcatacaaaagtatttccccttccatgatgcatggt
attgctgtttcaccaaacgctgcattcattgctgttgttacatctaaaccaatcatcatt
tcaagcatacaagtcaacaatgttgcattcctgtcttttaaacgcaacagcacaccatac
aatgcagccgtgacgttgcaatctgccgcgtttgaacaaaacagcttaaacgtgtgttat
cacttccttgatgtcattgaaataataagacaacattattttgtaaatcaaaatctggaa
acagttcttgaagaatttttaaccattgcaccaaataactatcaagatgaaactgttaaa
ttacaactcaggtggcatcttctacagataaagtactcgtatatcaattcatgtcaaaca
cctagtccttatagacagaatgagaatacagatccgaacaccaagcttctggaagagaaa
attaaagaggttgaattattgcttatcgttagtcaaatgctcaaagtaatcaagctctgg
tgtgaaaatggtgttccattagattccatggttccagttgttcagcttgttaaatggttg
gaaagcaataagtcaaaacttagcttacagagcagaaatgttatctaccaagctaaatcc
ctgcctgcatatctcatgctaccaacttgccctgtttgcttgattactggtcaagactta
gccttatgtttggatggtttgacatttttctctgaagatggttcaaggtggccagcatgt
tgtattacgtttagtccattgcaaacctacaagaaacgaaaatcttcatgttcatcacta
tttggaaagaaatgcgaaataaatgatcctgaatggatcaaagaacttctgtcgatggag
tgtttgttttctggcactccgttaatctga

DBGET integrated database retrieval system