KEGG   Ciona intestinalis (sea squirt): 100180695Help
Entry
100180695         CDS       T01056                                 

Definition
ubiquitin carboxyl-terminal hydrolase 31-like
Orthology
K11852  
ubiquitin carboxyl-terminal hydrolase 31 [EC:3.4.19.12]
Organism
cin  Ciona intestinalis (sea squirt)
Brite
Enzymes [BR:cin01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100180695
Peptidases [BR:cin01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100180695
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 806 aa AA seqDB search
MGQYKIDLKNCRKDRSKKYGTKGEVIELMATLVRSLWTVTYTQDMTKSLKDGISKYASQY
KGSSQHDSQEFMLWLMDKMHEDINMMPAKKRSFTRKQSFRKSSRKFSVEKTAEDSAAAPK
LAVDLSPTSFVQKVFQGHYRSSLSCPNCKKRSDTTDPFLCVSLPLKQRTTRPMYVNVVYL
PNKRRSGLGRKHMAGKTIKIGVSVPLDGKINDLRQAVAAECGIHSRLLAFVDLQHDGFHK
AYGDDYALIDFPMNNSSTTAVNMSLYAFEMPPIAKMTAGTLPRNFASSHKKRATIAGKFG
KDGNEGNTSNSIPDSIVVILINKQGVREQGKRFGRPLVFRASRDVLSSELQSMILNQMSD
QLKNGVKHERMGSLFRLQAKDGIPNKSYLSQQAQQPLRLPTVDKALENCPAGGPLHIKLV
AEWDTDTKCGIFEKFPEEKVEVQDSVRLQKVVHQQPVTCTLEECFDLHTQVEELGAEDAW
LCPHCKKQQQGTVKKLSLLTLPDILVLHLKRFRVTDGRRTKLCTRVEFPVTGLNMSKHIF
SNDMNGHSLPDSPKSYGNAWNPTYPPHLPTTVGPEDHLYDLYAVCNHYGNLNSGHYTACC
SNPLDGKWYLFDDNHTESITEDALSPQSVYILFYQRRSASAALSCGGASINSVMSEHWAF
QLPQFKQKIQFNSQSHLNHHSVAQVSRVKTFSVSRKSETLSSPVDGHLAMKINSNNNSNK
IAAAASKLQAANKRKEPRQSVVSSEDVDDGGFDSPTRPYLRGLRRQGSAIIGKSREDDRD
RSELRGRQYRSYRHNRTTRRQQSSHV
NT seq 2421 nt NT seq  +upstreamnt  +downstreamnt
atggggcaatacaaaatagatttgaaaaattgtagaaaggatcgtagtaagaagtatggt
actaaaggtgaagtaattgagttaatggcaactcttgtaaggagcttatggacagtaaca
tatacccaagacatgacaaaaagtttaaaagatggcatttcaaaatatgcttcacagtat
aaaggctccagtcagcatgattctcaagaattcatgttgtggctgatggataaaatgcat
gaagatataaacatgatgcctgctaaaaagcgctcatttactcggaaacagtcattccga
aaaagctcccgaaaattttctgttgaaaaaactgctgaagattctgctgctgcaccaaaa
cttgctgttgatttatccccaactagttttgttcaaaaagtttttcaaggacactataga
tcaagtttaagctgtcctaattgcaagaagcgcagtgacacaacagacccatttttatgt
gtttcgctccccttaaaacaaagaaccactcgtccaatgtatgtgaatgtggtgtatctt
ccaaataaacgacgaagtgggctgggcagaaagcatatggcgggtaaaaccatcaaaatt
ggtgtttctgtacctcttgatggtaaaataaatgatcttagacaagcagtagcagctgag
tgtggtattcactctagattactcgcttttgttgatttacaacatgacggttttcacaaa
gcatatggggatgactatgctcttattgatttccctatgaacaactcttcaacaacagcc
gtaaacatgtcattgtatgcatttgagatgccacctatagccaagatgacagctggaact
ttaccgcggaactttgccagtagtcacaaaaaaagagcaacgatagctgggaagtttggg
aaagatggaaacgaaggcaacacaagtaattctattcctgatagtatagttgtgatcctg
attaataaacaaggagtaagagaacaaggaaaaaggttcggtcgtcctcttgtttttcgt
gcatccagagatgttctttccagtgaacttcaatctatgattcttaatcagatgagcgat
caacttaaaaatggtgtcaagcatgaacgtatgggttcattgtttagattacaggcaaag
gatggtattccaaacaaaagttacctctcccagcaagcacaacaaccacttcgtttacca
acggttgacaaagcattggaaaactgtccagctggaggtcctcttcatattaaacttgta
gcagagtgggacacagataccaagtgtggaatatttgaaaaattcccagaagaaaaggtt
gaagtccaagatagtgttcgactacaaaaagttgtccaccaacaaccagtgacttgcaca
ttggaagaatgctttgatcttcatactcaagtggaggagcttggagcagaggatgcatgg
ttgtgtccacactgtaagaaacaacagcaaggcacagtgaagaaacttagcctactaacc
ttgcctgatatattggtgttacatttaaagcgtttccgagtgactgatggacgcagaacc
aaactttgtaccagggttgagttcccggtaactgggttaaacatgtcaaaacatatattt
agcaatgatatgaatggtcacagtttgcctgattcaccaaagtcttatggaaatgcttgg
aatccaacctaccccccgcatcttccaaccacagtgggaccagaagatcatttgtatgat
ctttatgctgtttgcaaccattatggaaatcttaactccggtcactatactgcttgttgc
agcaaccctttagatggaaaatggtacttgtttgatgataatcatacagaaagcattact
gaagatgccctttcaccacaatcggtttacatcttgttttatcaacgtcgatctgcttca
gcagcgctatcgtgtggaggtgcttcaataaactcggtcatgtccgaacattgggcattt
caacttccacagtttaaacaaaaaattcagtttaactcacaaagccacctgaatcatcac
tcagttgcacaagtgagtcgagtgaaaacattctcggtgtcaagaaaatctgagacttta
tcttcacctgttgatggccaccttgctatgaaaattaattccaacaacaacagcaacaaa
attgcagctgccgcaagtaaactgcaggctgctaataaaaggaaagaaccacgtcagagt
gttgtgagcagtgaagatgtggatgatggtggtttcgactctcctactcgaccttatcta
cgaggtcttcgtcgccagggatcagcaattattggaaaatcgagggaagacgacagagat
cgcagtgaattacgtggtcgtcaatatcgctcgtacagacataacaggaccacgcgaagg
cagcaatcaagtcatgtgtga

DBGET integrated database retrieval system