KEGG   Ciona intestinalis (sea squirt): 100180972Help
Entry
100180972         CDS       T01056                                 

Definition
(RefSeq) histone-lysine N-methyltransferase 2A
  KO
K09186  
histone-lysine N-methyltransferase MLL1 [EC:2.1.1.43]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100180972
Enzymes [BR:cin01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100180972
Transcription factors [BR:cin03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    100180972
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
10
AA seq 3563 aa AA seqDB search
MATAAKGSFPGRPRKKIEKKKVKFKREAHRKDLGDLNVTCSFITNISRQFHRIFDDENEQ
DIEFIGFSSEECGLRAYKRVTKKNAARSQSTRRSDILGSQSNYDQEKVTTRLSHARHSVS
NEPSDKSSQETPHSTISSPLSSPDRSLNFSRDTESCNSSSSDSAFLKYKDFKLDFHRLSR
KARNKDSECSAEEIAKRKDTSVKSLQYASDIYLAKDHSSVSAARSPIKPATFIPPGNTDS
QLHVSSLSGTSMKIKKVSRDFDEVGGNRKGAGHPHVIAKALLARANRQNKRNVEEQGLPA
QPTKQKTTKKAFILPSKSARSSRIIKANRKYLVDQHTTENTPPASLSPSTSDLISSSSSC
SVNISRQESQIAEPLTPTKTGISQKSPESKKRKPLIKQPTFLSDNSNTSGRSKSGSRFKE
INRKAHSHSHARRLIKRARFKHPTSSETLILGDEDPNNMSSSFIKEATFKAPNSKKRGSK
SQQSENIPETIEVTEEEPELFPDHIWKKIGKPLSERYAGDNTEAWSAQEIHNILHGSHTF
GNSWTTVARHYDFKDGHRDWLSVRQKALKCRSLGILNAEFKVKSSTLLQLKPKLSDNPNV
TVFSPLELKVRGLTHNVSCHLGSAGRAYINKEQLVTAPPVGEACSDIRIFGTQLNGQSSN
KSVNKNKIVDHDVYLGVSERVFMTLLKPRKRQVKLRWEIWEIHNILHGIAYLGLGEWTKI
YNMYRFHISHDNVAIRAKFKSICARGFIVSNTVREDVLPHLRPVLTEAGREYFLNKNLPI
VEFVVKVGKKMAKQKFNDGMVKMKKPEKIRRPSSSESDQELNISPPRKQAYHLFGAVPVW
DEAAHPDIIEDAETPVLEVLENGLCNGNLSSSDAPHHFSSKKNNLPPSSSGSTEQEPGAK
STKSSKSSKKKTTPDTKGRGPRIKHVSRRASLVTGHSLAKNEDATPHLSALPKVEREKIA
AAVEKMKVHIPDFTSSESEEDSKAKTSLPSTVPRREKIIPGKRKTMSLRCGVCETCSNVC
GMCDGCRSSKVDGSSICSERKPCSNPTEVDPVPHLPKKAKKSLPDQTASRKSSRLQQQRA
PLRSSLISDASGGQMSKHHQPPPSVFISPTTNNDTKTTTVLKEVTMSPGSRFSAFENVLT
LNKLATISIENWKEIYEVSRLWKKGGRALITSQPPPPRTVCLICGSFSSAKSISEGALVH
CACCCEPYHPFCAEPDFLNTDVLAQMKRNTWICRKCQCCHVCGHPKNLLVCRRCKKSYHS
ECLGPSYPTNCYSDEDYESRMIQCSGCKRWVHSKCESLSVEMYTLLAHMPNNVTYKCPDC
DNRGTKLKQILAEQANAAEELNESIKPEPEEIRKILSSLPPPAWRKMIENEIQTGLEAIT
MALFHNRATYGILKKADNIKPEADTKPLKCDDTARPRDLFAVRFAVHNGRYHSVGTFCSH
VAAILDSVADDNDREEVGKAFCKEAGSVFSWFNFETGKADSIKPEADTKPLKCDDTARPR
DLFAVRFAVHNGRYHSVGTFCSHVAAILDSVVDDNDREEVGKAFCKEAGSVFSWFNFETG
KVRDSNDFPDYLLPNATMPPTPEHDYAQWQDKDIVTHPGTPDPSPMKSQCSTTPSKSDTW
ASPLKNNEDLRQCIFCSKYGDDHPMYAGRLLYCSQDEWCHVNCALWSAEVYEQHDGSLQN
VQSAASRGKMMKCELCKLPGATVGCSTRQCPKNYHFMCARKTDCAFQNDKKVFCLRHHSN
ANIELIYDEEFEVLRMVCVDNDEMRPNRRWQRGVLSSNITVTIGSLTVHQLGRLGVASDI
RDCLIPASFRMTRVFWSAFSPTRKTVYTITVSEKKPSFDGNQSKPAADNTNLTISHASED
EHPAPSSPPSSKSKLHSPPHPCVTNLLDRMDSIPPIGPLSPTRRSSHRNERRPTGSYTII
SSFNKTLPQMLTPLPTTPKYTTPEPNTPTPIKPTKISPDNPFLRPILSDATPKTLPLTLI
PQNGEKEQICSESVVSYPNMTLNSGTSGLIISTTSSQNQLKPNLTESCEKTITTSNSDNE
KITPLVSETQNKMDTGTSSVSVQPTTTVHETIPCNSVVNIAINASEENLSPKSLPITVSS
EEKITEVQEELKDVGTSVVKDKDVSKIIVPTSISPPNKNENLGADPGMQVSLLRDAKIAR
DVEDTEHQKTSPMEVSGLWWKKQPPVKKSSSSSKIWKTPRSGSNPEDFDPSFKSDEKYWK
LKPGETESKSLSSGGSVGKRKKIIESYHEEDVKMDSESDGEDKFASGESGDAKIENVPKV
PVITSKEESLDESLKNVTSVSNTPNAVPPKEVSHLEANVSDETLTITEESYQKPTTPKLI
VRCQKLKMSEKNEICENDSDHAEDREESPKLPAKSMRKFARKSVDEVNQIKPVISSSPQR
HMLTRQRSKSQDDAFRFNKHFKTKENTCSNENLSDLNSKFINTRSRSRNSSVSISVLPVS
HPESPECNLNSSVANSQTSSAEENEKSLSDNTEHDNLNTPRRYPRRNTYTCLRSFSGLSP
NYALASYSRLLSQAHEEKPDVKVTHTDAVDDGKSKHDPHEPMSPKTEKMPKENADVKVTH
TEAVDGKSKHDLYEPLSPKSEENPEEKETQILTVDSPIVTEEKTDEKRDNDISSYEKCIT
KSPDQLTSHIDEAKEMKMHLSAVDDQITSDDLKVSENNISTENLSPETEPANTESKGEVK
MTTDDEELKTSNKIFDDPASDFYNEVKINEEDVECEEQNCPDANLSEKSLDEKDDNESNI
IEILSALPEVSPLIPSPPNLNLDDSANFGDDSIEIQRGGSEDLPPGGTIESPHPKISPEK
ISENNLTETLKDVEEIPDVTVESLKDDSSFLVTSECPVLNADEVQTLLESPETITTTPTM
DYNYIRPVHPQTVCQPTILNYPVYSTGRHPQTTRFPNCTPKPRPSFRRHSQESIQPIYNN
RGKVPPAPQAPFQKLVTMTAHPWIRNTPVIVQPSVSPVRIAYPPSQNITPNFHPMPPNMS
YPQQYPPMPGIATTPLSYSLRVTMAMAGSINTDTLSPTTIPRFNFANQPQKPQPASYRQQ
PVNQSYPLPNQYTNLPNPAAHNQNTQDLGEQAAALERLIEFYSAKNNLTGEEKKIVRSII
SAQIQNKQLPMPNAHHTQLTGNQNKAEEKDTKSSGHKRRRSFEAKQEEKKSKIKRKKKER
LNLLSTGLDESLPLYDDDVDDIDTGSILVDIYNKREELLKRKKKPFSRLLAPYNIFIGQN
HSSNKGNRTTPPHTTNKPYMVYEITSEDGYSAQGTDLQDLVSQLLSAVQECRATTKGPSP
TVALHAVMTPFSFLGVSHDAVRFLAEQLPGARYCHRYRAKYHKHKKTTEEVTHINPHGCA
RAEQYKGRSKPDMFSFLASKHRYPPVYDPDRQEDDLQQINRRATSCDLPMAMRFRQLRHL
TRDSVGVYRSTIHGRGLYCKRDFDSGEMIMEYTGQIIRQELTDKREKYYESKSIGCYMFR
MDDFYVVDATVLGSGARFINHSCDPNCYSRIVQFEGKKHIVIFALREIYKGEELTYDYKF
PIEDENHKIACTCGARLCRKFMN
NT seq 10692 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgctgctaaaggtagttttcctggtcgaccaaggaagaaaattgagaagaaa
aaagtgaaatttaaaagagaagctcacagaaaagatctgggagacctaaacgtaacctgt
tccttcattactaatatttcaaggcagtttcatcgaatttttgatgatgaaaatgaacag
gatattgagttcattggcttcagttcagaagaatgtgggctacgagcttacaaacgggtc
acgaagaagaatgctgcaagaagtcaaagtacaagacgttctgacatacttggaagccag
tcaaattatgatcaagaaaaagtgacaaccaggttatcacatgcgcgtcatagtgtttcg
aatgaaccttcagataaatcatcacaagaaactcctcactctacaatatctagtcctctc
tcatctccagacagaagtctcaacttcagcagagacacagaaagttgcaacagcagttct
tctgattcagcattcttaaaatacaaagattttaagttggatttccaccggttgagtcgc
aaagctagaaacaaggacagcgaatgcagtgctgaagaaattgcaaaacggaaagacacc
agtgttaaatcgcttcagtatgcttccgatatttaccttgcaaaagaccattcctctgtc
agtgctgcacgttcaccaatcaaacctgcaacttttattccacctggaaacactgactcc
caacttcatgtatcttcactcagtggaacctcaatgaaaattaaaaaggtgtcccgagat
tttgacgaagtgggtggaaatagaaagggggcaggccacccgcatgttatcgctaaagct
ttacttgctcgagctaatcgacaaaataaaagaaacgttgaagaacaaggcttgcctgct
caacccactaaacagaaaactacaaagaaagcgtttatacttcctagtaaaagtgcacgg
tcatcaagaattataaaagcaaatcgcaaatatttggttgaccagcataccacggagaat
acaccacccgcaagtctctcaccttcaacttctgacctgatttcaagctccagcagttgc
agtgtcaatatttctcgacaagaatctcaaattgccgagcccctcacccccacaaagact
ggcatctcccaaaaatcaccggaatccaagaaaaggaaacctttaataaaacaaccaaca
tttttatcggataactcaaacacttctggtcgatcaaaatcgggctcaagatttaaagaa
atcaacagaaaagctcacagtcacagccacgcaagaagattaataaagagagctcgattt
aaacatccaacgtcatctgagactcttattcttggtgatgaagatccaaataacatgagt
tcttcttttataaaggaagcaacatttaaagctccaaattctaaaaaacgtggttcaaaa
tcgcaacagagcgaaaatattcctgaaactattgaagtcactgaggaggaaccggaactt
tttcccgaccatatatggaagaagattggcaagccattaagtgagagatatgcgggagac
aatacagaagcatggtcagcacaggaaattcacaacattctccatggtagccatacattt
ggtaactcctggacaacagtggcacgacattatgactttaaggatggacatagagactgg
ttgagtgttcggcaaaaggcactcaagtgcagaagtcttggtattctaaatgcagagttc
aaggtaaaaagttccaccctactccaactaaaaccaaaactaagcgacaacccgaacgtt
actgttttctcgccattagagcttaaagttcgaggtctcactcataatgtgagttgccat
cttggatctgctggtcgtgcgtatattaacaaggaacaacttgtaactgccccaccagtt
ggtgaagcgtgtagtgatattaggatatttgggacccagttaaatggacaaagtagcaac
aaatctgtgaataaaaacaaaattgttgatcatgacgtttaccttggggtgtcagaacgt
gtgtttatgactttgcttaaaccaaggaaaagacaggttaagcttcgttgggaaatctgg
gagatacataacatactccatggtattgcctaccttggtctcggtgaatggaccaaaatc
tacaacatgtatcgattccatatttcacatgataatgttgctattcgtgcaaagttcaag
tcaatctgcgccagagggttcatcgtttcaaacaccgttcgagaagatgtgttgcctcac
ttgcgccctgtactgaccgaagcgggacgagaatattttctcaataaaaatcttccaatt
gttgaatttgtggtaaaagttggtaaaaagatggccaaacaaaagtttaatgacggaatg
gtaaaaatgaagaaaccggaaaaaataagaagaccaagctcctctgaaagtgatcaagag
ttaaacatcagtcctccaaggaagcaagcttatcatctcttcggagcagtccctgtatgg
gatgaagctgcacatccggacattattgaagatgcagagactcctgttcttgaagttctt
gagaacggattatgtaacggtaatctttcgtcttccgatgctcctcatcacttctcctcc
aagaagaataatcttcctccttcatcatctggatcaacagagcaagagccaggagcaaaa
tcgacaaagtcgtcaaaatcgagcaaaaaaaagacaacaccagatactaagggaaggggg
ccaaggataaaacatgtcagcagaagagcatctttagtaaccggacacagccttgctaag
aatgaagatgccactccccatcttagtgctctacctaaagtagaacgtgagaagattgct
gctgcggttgaaaagatgaaagtccacatcccggacttcacatcctccgaaagcgaagag
gactcaaaagcgaagacctccctcccgtccactgttcctaggagagagaagatcattcct
gggaagaggaaaacgatgagcttaagatgtggagtgtgcgaaacgtgttctaatgtttgt
gggatgtgtgatggttgcagatcatcgaaagttgacggttcatcaatttgttcggagcgc
aaaccttgctccaaccccacggaggttgatcctgttcctcatcttcctaagaaggcaaag
aagtctcttcctgatcaaacggcatcaagaaagtcttcccgcctccaacagcagcgagcc
cctctccgatcctcgttgatatcggatgcaagtggaggacaaatgagcaaacaccaccag
cccccgccgtcagtcttcatctccccaactacaaataacgacaccaaaaccaccactgta
ttgaaagaagtgaccatgtcacctgggagtcgattcagcgcgttcgaaaatgttttaact
ctaaacaaacttgcaacaatatccattgaaaactggaaggagatttacgaagtttcccga
ttatggaagaaaggtggtcgtgcgttgatcacctcgcagccgccaccccctcgcactgtg
tgtcttatatgcggctccttcagctcggcaaagagcataagtgaaggtgccttggtccac
tgcgcttgctgttgcgagccataccaccctttctgtgcagaaccagactttttaaacact
gacgtgttagcgcagatgaaacgaaacacatggatatgcagaaaatgccaatgctgccac
gtatgcggacacccaaagaacttacttgtgtgcagaaggtgtaagaagagttatcatagt
gagtgtcttggaccaagttaccctaccaactgttacagtgacgaggattacgaatctcgg
atgattcaatgttccgggtgtaagagatgggttcattccaagtgtgagagcttatctgtt
gaaatgtacaccctgcttgcccacatgcccaacaacgtgacatacaagtgtcctgactgt
gacaatcgtgggactaaacttaaacaaatactcgctgagcaagctaatgctgctgaagaa
ctaaatgaaagtataaaaccagagccggaggagatccgtaaaatcctctcaagtcttcca
cctcctgcatggaggaaaatgatagagaatgaaatacagacgggattagaagcgatcacg
atggctttatttcataacagagctacctatggcattctaaagaaggctgacaacatcaaa
ccagaagctgacacaaaaccactcaagtgtgacgacacagctcgacctcgtgacctcttc
gctgtaaggttcgccgtccataacggtcgctaccactcggtggggacattctgctcccac
gtggcggccatcttggattcggttgccgacgacaacgacagggaggaggttggaaaggcg
ttctgtaaagaagcaggatctgtgttctcgtggttcaatttcgaaacagggaaagctgac
agcatcaaaccagaagctgacacgaaaccactcaagtgtgacgacacagctcgacctcgt
gacctctttgctgtaaggttcgccgtccataacggtcgctaccactcggtggggacattc
tgctcccacgtggcggccatcttggattcggttgtcgacgacaacgacagggaggaggtt
gggaaggcgttctgtaaagaagcaggatcggtgttttcgtggtttaatttcgaaacgggg
aaagtgagagactcaaatgacttcccagactacctactacctaacgccactatgcccccc
acccctgaacacgactatgcacaatggcaagataaggacatcgtgacccaccctggcacc
cctgacccctcccccatgaagtcccaatgtagtacaacaccttcaaagtccgatacatgg
gcctctcctctcaaaaacaacgaagatttgaggcaatgtatattctgtagcaaatatggg
gatgaccatccaatgtatgctggtagattgttatactgtagccaggatgaatggtgtcat
gtcaactgtgcattatggtcagcagaagtatatgaacaacatgatggttccttacagaat
gttcaatctgctgcttcaaggggaaaaatgatgaaatgtgagctatgcaagttacctggt
gcaacagttggctgcagtacacgacaatgccccaagaactaccatttcatgtgcgccagg
aaaactgactgcgcttttcaaaacgataaaaaagttttctgtcttcgtcaccatagtaat
gctaacattgagttaatatacgatgaagagttcgaagtcctccggatggtgtgcgtggat
aacgacgagatgcgacccaatcgtcgctggcaacgaggagtcctctcatccaacatcacg
gtgacgatcggatcacttaccgtgcatcagttgggaagattaggagtggcatccgatata
agggattgtcttattcctgcttctttcaggatgacacgagtgttctggagtgcgttctca
cccaccaggaaaacagtttacacgatcacggtgtccgagaagaaaccttcgtttgatgga
aatcaatcgaaacctgcagcagataacacaaacttaaccatctcacatgcaagtgaagac
gaacaccccgccccatcctctcctccttcttccaagagcaaacttcatagtcccccgcat
ccctgcgttaccaacctccttgatcgtatggactccattccccccattggccctctctcc
ccaactcgacgaagttcccaccgaaacgagcgtcgtcctacaggctcctacaccataatt
tcatccttcaataaaactttaccccaaatgctcacccccctacccacaacccctaaatac
acaactcctgaacccaacacccctacccccatcaaacccacaaaaatctccccagataac
ccgtttttacgacccatcttaagcgatgcaactccaaagacattacccctaactttaatc
ccccaaaatggagaaaaagaacaaatttgctcagaatccgtcgtcagttaccccaacatg
actttaaacagtgggacatcaggtttaatcatttctaccacaagctcacaaaaccagtta
aaaccgaatttaaccgaatcctgtgaaaaaacaatcactacctcaaattcagataatgaa
aaaattacaccactagtttctgaaacacaaaacaaaatggatactggaactagttctgtc
tcggttcaacctactactacagtacacgaaactataccttgcaattcagtagttaacatt
gctattaatgcatctgaggaaaatttaagtccaaaatcactgcctataactgtgtctagt
gaagaaaagattactgaagtccaggaagagctaaaagatgttggtacatcagttgtaaaa
gataaagatgtttcgaagatcattgttccgacgtcaataagtcctccaaataagaatgag
aatttgggagccgatccagggatgcaggtatctcttcttagggatgcaaagatcgctaga
gatgtagaggacacagagcatcagaaaacttctcctatggaggtttcaggactttggtgg
aaaaagcaacctccagtgaagaagtcctcctcctcttctaagatctggaagactccaaga
tccgggagcaatccggaggactttgatccttcttttaaatcggatgaaaagtactggaaa
ctaaaacctggggaaacggaatcaaaatctctctcttctggaggatctgttggtaagagg
aagaagatcattgaatcgtatcatgaggaggatgttaaaatggactctgaatctgatgga
gaagacaaatttgcatcaggagaaagcggagatgcaaaaattgaaaatgttcccaaagtt
cctgtaataacaagtaaggaagaaagtttagacgaaagtttgaaaaatgtaacttctgtt
tcaaacactcctaatgctgttccaccaaaagaagtttctcatctagaagcaaatgtttcc
gatgaaactcttacaataacagaggaaagttaccaaaagccaactacacctaaactaata
gttcggtgtcagaaattaaaaatgagcgaaaaaaatgaaatttgtgaaaacgacagcgat
catgcagaagatagagaagaatcgccaaaacttccggcaaaatctatgagaaaatttgcg
cggaaaagtgtggatgaagtaaaccagataaaaccggttatttccagttccccacagcgc
catatgctcaccaggcaaagaagtaagtcccaagatgatgcattcaggtttaataaacat
ttcaaaacaaaggaaaatacctgttcaaatgaaaatttgtctgatttaaattcgaaattt
ataaacacaagatcacgttccagaaacagcagtgtttccatatcagtgttgccagtcagt
catcctgaatccccagaatgtaaccttaacagcagtgttgccaattcgcaaacctcaagt
gcagaagaaaatgagaaaagtttatcggacaacactgagcatgacaacctaaatacaccg
cgtagatatccacgcagaaacacttacacgtgtcttagatctttttctggcttatcacca
aattatgctcttgcctcttactccagactgctcagccaagcgcatgaagagaagccagat
gttaaagtcacacatactgatgctgtagatgatggaaaaagtaaacatgacccacatgaa
ccaatgtcaccaaaaactgaaaaaatgcctaaagaaaatgcagatgttaaagtcacacat
actgaagctgtagatggaaaaagtaaacatgatctttatgaaccattgtcaccgaaaagc
gaagaaaatcctgaagaaaaagaaactcaaattttgacagtagactctcctatagttact
gaggaaaaaacagatgaaaaaagagataatgatatatcatcatatgaaaaatgtatcacc
aagtcacctgaccaactcacaagtcatatagatgaagcaaaagaaatgaaaatgcatctg
tctgcagttgatgatcaaattacttcagacgatttaaaagtatctgaaaacaatatttca
acagaaaatttatctcctgaaactgaacctgcaaacacagaatctaaaggtgaagtaaag
atgacaaccgatgatgaagaattaaaaacctccaacaagatctttgatgatcccgcatcc
gacttttataatgaagtgaagatcaatgaagaagatgttgaatgtgaagagcagaattgt
ccagatgccaacctcagtgaaaaatccttagatgagaaagatgacaacgagagcaacatt
attgagatcctctcagctcttccggaggtctctcctctaatcccaagtcctccaaatctc
aatcttgacgactccgccaactttggtgatgactcgatcgaaatccagcgaggaggatct
gaagatctaccaccaggaggcactatagagtctccacatccgaaaatctctcccgaaaaa
atttccgaaaataatcttacagaaactctaaaagacgttgaagaaattcctgatgtaact
gtcgaatcattaaaagatgactcatcgtttctggtgacgagcgaatgcccagtgctaaac
gctgacgaagttcaaacccttcttgaatccccagaaaccatcactaccacccctaccatg
gattacaactacatacgtcccgtccacccccaaacagtatgccagcctactatattaaac
tacccagtgtacagtacaggacgtcacccacaaaccacacgcttcccaaactgcacccca
aaaccccgtccctcattccgccgtcacagccaagaatcaatccaacccatctacaacaac
agagggaaagtccctccagccccccaagccccattccagaagctcgttacaatgacggcc
cacccctggattagaaacacccccgtaatagtccaaccctccgtttccccggtccgaatc
gcttacccaccctcccaaaacatcacccccaactttcaccctatgcccccaaacatgtca
tacccccaacagtacccccctatgccaggaatcgctacaacccccttatcctactcccta
agggtaacaatggcaatggcgggctccataaatacagacacattatccccaaccacaatc
ccgagatttaattttgcgaaccagccacaaaaaccgcaaccagcttcgtacagacagcaa
ccagtgaaccagagttaccccttgccgaaccagtacaccaatttacccaaccctgcagca
cataatcagaacacccaggacttaggagaacaagctgcagcgttggaacgactgatagaa
ttctacagcgcaaagaataatctaactggtgaagaaaagaaaattgttcgttccataatt
agtgctcagatacaaaacaagcaactgccgatgcccaatgcacaccatacacaacttact
ggtaaccagaacaaagcagaagaaaaagataccaaatcctccggacacaaaaggaggaga
tcatttgaagcgaaacaagaagagaaaaaatcaaaaattaaacggaagaaaaaggaaaga
ttgaatctcctatctacaggacttgatgaatccctcccattatatgatgatgatgttgac
gacatagataccgggtcaattttggtcgatatttataataaacgtgaggaacttcttaaa
aggaagaagaaaccgttttccaggctactagctccgtacaacatattcatcggacaaaac
cattcctcaaacaaggggaaccgtaccacaccaccccacactactaacaaaccatatatg
gtgtatgagataactagtgaagatggatactcagcacaaggcactgatttacaagatcta
gtcagccaattgctatcagccgtgcaggaatgcagagcaaccacaaaaggaccgagtccc
actgttgctctgcacgctgttatgacaccattctcatttctgggggtttcccatgacgca
gtgagatttctggcagagcagttgccaggtgcgagatactgtcatcggtacagggccaaa
taccacaagcataagaagacaactgaagaggtcactcacataaatccacacgggtgcgct
agagcagagcagtacaagggacggtctaaaccggatatgtttagtttcctcgcatccaaa
cacaggtatccacctgtttatgaccctgatagacaagaggacgacttgcaacagataaac
agacgagcgacctcttgtgacctcccgatggcgatgcgattccgtcagctacgtcatcta
acacgtgactcggtgggcgtgtatagatccaccatacatggaaggggcttgtattgtaag
agggatttcgatagcggggaaatgatcatggaatacactggacagataattcggcaagag
ctcactgacaaacgtgaaaaatactacgagagcaaaagcatcggttgctacatgtttcgt
atggacgatttctacgtagttgatgcgactgtgcttggatctggagctcgtttcattaac
cattcatgcgaccccaactgttattcccgtatcgttcaatttgaaggcaagaaacacatc
gttatcttcgcattgagggaaatatacaaaggtgaagaactgacgtatgattacaagttc
cctatcgaagacgaaaaccataagatagcttgtacctgcggcgcacgcctttgccggaaa
tttatgaactga

DBGET integrated database retrieval system