KEGG   Ciona intestinalis (sea squirt): 100181200Help
Entry
100181200         CDS       T01056                                 

Definition
profilin-4-like
Orthology
K05759  
profilin
Organism
cin  Ciona intestinalis (sea squirt)
Brite
Exosome [BR:cin04147]
 Exosomal proteins
  Proteins found in most exosomes
   100181200
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 151 aa AA seqDB search
MANLWMEGDRYQIKGVPDRVKMNQLNNLLHDSLISTEHVEKCAILDRKEKEQRAGSPGFV
LQKDQILSLQEAFKKCSMIRKEGICFEDKNYKCTRADKNSIYAKQLQSNDGMIITQTATL
LIVATYTERMFPSVCVEAMEKLTDYFREKGR
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacttatggatggaaggagatcgctaccaaataaaaggggtaccggatcgtgtg
aagatgaaccagttgaacaacttacttcatgattcactcatatcaacagaacatgttgaa
aaatgtgcgatacttgatcgaaaagaaaaagaacaaagagctggttctcctggatttgtt
ttacaaaaagatcagatcctttctttacaagaagctttcaagaaatgttccatgataaga
aaagaaggaatttgttttgaagataaaaactacaaatgtacaagagctgacaagaactcg
atttatgctaaacagcttcagtctaatgatggaatgattattacacaaactgctactctg
ttgattgttgcaacatacactgagaggatgtttccatcagtttgtgtggaagccatggaa
aagttgactgactatttccgtgaaaaaggaagataa

DBGET integrated database retrieval system