KEGG   Ciona intestinalis (sea squirt): 100181205Help
Entry
100181205         CDS       T01056                                 

Definition
protein O-mannosyl-transferase 1-like
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:cin00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2
AA seq 664 aa AA seqDB search
MPHTYKYFGLFILIASGGFIRCLNLGHPNGVVFDEVYYGSACSLYKNHQFFVDKHPPLFK
ILACSLMFEEHMTNSVIWSHIGNEFPKDFPISFVRMFPAILGVATIPATYYFVVSCGFSH
FAATVSSLLVTFDNGLIVQCRILTSDSFQQCMLLIALCFANRNSLFGFALSFLCIGAVIS
TNTSLYYVWFMISYLALKRSTFYFADTNTSLEKCLIRGVLCISTSVIPILVYIFTIATHV
SLLPSSGPHDNILSSSFQSSLLGNIHETNVTFGSFTYLHTTDETSLYVPCYLRSVFPLHS
TSHNNNVSNFGEPNIMCNTFKDEQSIWQIIHPVNWNIETTVKDKDIVYLQHEKSKHYLTT
HNVAAPVSINKQQVTSCVNNTQLFEYEWQVILDENGPWINEISKVRFLHVKTQTFLTSTE
KYLPNGVNKESEVACEEASLQNTACSTKWNSEVLHNFRGETRSKTFGLWQKIMEFHRKSL
QVNSDSTVAHTFSSELVGWPLAQSNIAYWYNANINAQIHFVGNVVGWVGGVVSILFVLIF
CFLNCVLRRRRICYTTEDYWEKILFQSLFLLSAWVMHLLVLYVEEASFIYEYAPAVVFTY
VLQGVAFDVLHLHCGWFAYIIACLYTTAVIKCYWSLRSITFGFPLTSESLNNLFWWSSWE
FLAV
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgccacacacttataaatattttggtttgtttatcttaatagcaagcggtggttttatt
cgctgtttaaatcttggacatccaaatggagttgtgtttgatgaagtgtattatggttct
gcgtgttcactctataagaaccatcagttttttgtggacaaacatccacctttgttcaaa
atccttgcttgttcattgatgtttgaagaacatatgaccaacagcgttatatggagccac
attggaaatgaattcccaaaggactttccgatttcatttgttcgaatgtttccagcaata
ctaggtgtggcaacaatcccagccacatattactttgtagtatcatgtgggttttcacac
tttgccgcaactgtttcttctttattagttacctttgacaatggattaatcgtacaatgt
cgaatcttaacgtcagattcttttcaacaatgtatgctcctcattgcattatgttttgca
aatcgaaatagtttgtttggatttgctttatccttcttgtgcattggagcagtcatatcc
accaacacatcgttatactatgtgtggtttatgatcagttatctcgcattaaaacgttcc
actttctattttgctgataccaacacatcactggaaaaatgtttgattcggggtgtcttg
tgtatttcaacttcagtcattcccattcttgtttatatttttacaatcgcgacccatgtt
tctctactaccatctagtggcccccatgataatattctttcatcttcatttcagtcatca
ctgttgggaaatattcatgaaacaaacgtaacatttggttctttcacttatcttcataca
acagatgagacttccttatatgttccatgctacttaagatcagtgtttccattacattct
acttcacacaacaataatgtatctaactttggggaaccaaatataatgtgcaacactttt
aaagatgaacaatctatttggcagattatacacccagttaattggaacattgaaacaaca
gtgaaagacaaagatattgtatatttgcaacacgagaagtcaaaacattatttaacaact
cataatgttgctgcacctgtgtctattaacaaacaacaagtaacaagttgtgtgaataat
actcagctttttgaatatgaatggcaagttatattagatgagaatggaccttggattaat
gaaatatcaaaagttcgatttttacatgtgaagactcaaacatttctgacgtcaacagaa
aaatatttgccaaatggtgttaacaaggaaagtgaagttgcttgtgaagaagcatcgtta
caaaacactgcgtgttcaacaaaatggaactcagaagttcttcacaacttcaggggcgaa
acaaggagcaaaactttcggtttatggcaaaaaattatggagtttcatagaaaatcactg
caagtaaattctgattcgactgtagctcatactttcagttcagagcttgtgggttggcca
ttagcgcaatcaaacatagcatattggtacaatgcaaatatcaacgcacaaatacacttt
gtggggaacgttgttggttgggtggggggagttgtctctattttgtttgttttaatattt
tgtttcctgaattgtgttctacgaagaagaagaatttgttatactaccgaagattactgg
gaaaagattttattccaaagtttatttttgttatctgcgtgggtgatgcatctacttgtg
ttatatgttgaagaagcaagttttatatatgaatatgcaccagcagttgtttttacttat
gttcttcaaggtgttgcatttgatgttcttcatttacactgcggttggtttgcttacatc
atcgcttgcctttacacgacagcagtgatcaaatgttattggagtttacgttctataact
ttcggtttcccacttacttcggaatctcttaacaatcttttttggtggagttcttgggag
tttcttgctgtttaa

DBGET integrated database retrieval system