KEGG   Ciona intestinalis (sea squirt): 100181565Help
Entry
100181565         CDS       T01056                                 

Definition
tyrosine-protein kinase SYK-like
Orthology
K05855  
spleen tyrosine kinase [EC:2.7.10.2]
Organism
cin  Ciona intestinalis (sea squirt)
Brite
Enzymes [BR:cin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100181565
Protein kinases [BR:cin01001]
 Tyrosine protein kinases
  Syk family
   100181565
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
10
AA seq 635 aa AA seqDB search
MAGQLYDEVYYHGPISRSEATELVKGQVDGSFLLRKSLREPDGYAISVSYQGSVLHYSIQ
HSTVSGWYSVNKGSEHPSPQALCKYYMQEKGGLKTKLLWPIKVASSPPPQTPPHSPQYQQ
PLPPLPQVRPGRSGSTVSYEEQEWYHGEITRQEDAVRLSHSYRELNKNGIYLIRFKENGV
FVLSVVNDKKVHRYKILQNTSNLKYSINGKPPEFLSLEQLIQFHEEQPPEISHLHCRLTL
PCKRSTSASVIPQNCFKHLVSQQQRTNSHNASSKRLSGFASALAAEFKSLLPANGLDVNW
SENPHQLNLSENPVSQRPQSSLNGKVGKPVMDRFSRSSLPKDSIGYKSPYMNFSDKSSLA
PDLYITTDKLIIRGDIGKGHFGAVKVGECKIMGSFVPCAVKNLTGSDIETNKNDLLKEAK
LMQQFDHPYIVRLLAICDAMESSGSLMLVMELAPLGSLKDFLSQHNEKSFPEERLLVLMN
QVCDGMAYLSGKNIVHRDLAARNILLVTENFAKISDFGMSRIFLESDNYYKASQPGTWPL
RWYAPEALLYYKFTSKGEIWSFGVTLWEVFSYGSRPYSGLKGREILAMLEGGKRLECPCG
CSPGVYTIMLQCWAYDPEDRPTFNDLLLQFKVFIG
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atggcaggtcaattgtatgatgaagtttattaccacggtcctatttcccgttctgaagct
acagagttggtgaaagggcaagttgatggctcgtttttgttgaggaaaagtttaagggaa
cctgatggttatgctatatccgtgtcttaccaaggcagcgtgctacattacagcatacaa
cactcaacagtaagtggatggtatagtgttaataaaggcagtgagcacccttcaccgcaa
gcactttgcaaatattacatgcaagaaaaaggtggattaaaaacaaaacttttgtggcct
ataaaagtggcctcttcaccaccaccgcaaaccccaccccactcaccacaatatcagcag
cccttgcctccattaccacaagtaaggccaggtagaagtggttcaactgtaagctatgaa
gagcaagaatggtatcatggggaaataacgaggcaagaagacgctgttcgactttctcat
tcttatcgtgaattaaacaaaaatggaatatatcttattcggtttaaagaaaatggagtt
tttgttcttagtgtagtgaacgataagaaagtacacagatataaaatactccagaatact
tccaaccttaagtattcaatcaatggaaaacctccagagtttttatcattagaacaactt
attcaatttcatgaggagcagccaccggagatttctcatcttcattgtagattaacactc
ccttgcaagagaagcacttctgcatcagttattccacaaaactgctttaaacacctggtc
tctcaacagcaaagaacaaattcccacaacgcatcgagcaaaagattgtcaggattcgcc
tcggcacttgctgctgaatttaagtctctactgccagctaatggccttgatgtgaactgg
tcggaaaatccgcaccaactaaacttgtcggaaaatcctgtctctcaacggccacagtca
agtctaaatggaaaggttggaaaaccagtaatggataggttcagcaggtcatcactgcct
aaagattcaattgggtacaaaagtccttacatgaactttagtgacaagtcgagtcttgcc
cctgatctgtacattacaacagataaactaatcataagaggtgatattggaaaaggtcat
tttggcgctgtaaaagttggtgagtgtaaaataatgggttcatttgtcccatgtgctgtt
aagaatctaacaggttcagatatagaaacaaataaaaatgatcttttgaaagaggcaaag
ctcatgcagcagtttgatcatccttatattgttcgtcttcttgctatctgtgatgccatg
gaatcttctggaagtctgatgctggttatggagcttgcacctcttggttctttaaaagat
tttttatcccagcacaatgaaaagtcttttccagaagagcgacttttggttttaatgaac
caagtatgtgatggaatggcttacctgtcgggcaagaatatagtgcatagggatctggca
gcaaggaacatacttcttgtgacggaaaactttgcaaagatatctgactttggaatgtca
cgaatatttcttgaatctgataactactacaaagcaagtcagccagggacatggcctttg
cgttggtatgcacctgaagctctcctgtattacaagtttacaagcaaaggtgaaatctgg
agttttggggtgactttgtgggaagttttctcttatggaagtcgaccatattcaggttta
aagggcagggagatcttagccatgttggaaggaggaaaaagacttgaatgcccgtgtggg
tgctcacctggtgtgtataccatcatgctacaatgttgggcatatgatcctgaagataga
cctacttttaatgatctactcttgcagtttaaagttttcataggttaa

DBGET integrated database retrieval system