KEGG   Ciona intestinalis (sea squirt): 100181714Help
Entry
100181714         CDS       T01056                                 

Definition
glycogen debranching enzyme-like
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100181714
Enzymes [BR:cin01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     100181714
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.33  amylo-alpha-1,6-glucosidase
     100181714
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 1512 aa AA seqDB search
MASTSNNSVDQIRILKLVDGKHCENTLYRLQKGWTIRFMLGPDLASQKVTVYTNIPPSEQ
PFKRTVYYPLSWELLTKSGINSLDAYAPVKLSHSGAFQYYFTYNDKKAGSGYFIVDPTLC
IGMDNHVLPLDAVCMQTLLPKSLGQFCDWKDRLLVAKESGYNVLHFTPIQKLGCSNSSYS
VSDQMAVNPSFYSSVPVTFNDVENLVEEIRRDWEMLSVTDVVWNHTDKHSSWLKTYPESA
YNLHNSPYLRPAYILDRAIFHLTLDIEKGKKYASYFPLSIIETEKDLESLKVILLKNVLP
GLKLWEFYQVDVPKQVEHFTQAVKSFKQNGNVTKDVKIKIIQDPNFNRLQCSVDIQAAVE
QFYAGSDCDLDRAVSSFVSTLEWLNRVKKETVMSDLFSAVNNIIAGVRYERLAADGPKVV
LLNKQHPLTTMYFHHQFEDSTVDEEEQFVFGDTKNSKFIMAHNGWVMGANALENFAEYPG
KVYFRRELVCWGDIVKLRYGSSPSDCPPLWERMKQYTEMTARIFHGIRIDNCHSTPIHVA
EYMLDAARKIRPDVYVFAELFTGSEEVDNIFVNRLGLTSLIREALNAWDAHELGRLVYTY
GGEAISSFIQPATQILQPSRAHALFYDITHDNESVIVKRSIRDVLPFSALVSMSCCAIGS
NRGHDEMTPHHINVVNEKRKYRKWNSALNSGSEFVGIKSGMIQGKHLLNVLHQTMAMNGF
TQIFVDQRTQDVVAVTRHNPQTHYSYILVGNTSFSDSKMKPVPPMLVEGSIMGIPLEAKP
SETEQSTQDYLKGFTKDKQFINGIDNYNLVVDTDIAASNSTCCKILESEDKSSQTVHFTH
FPPGSIVVLRVKVTETVNKSISDIRETIASLHNSNTHFDKLVSKLNLRTLNRVLFRCNEE
EMSDGFGISAYQIPSWQKLCYCGIAGIAIPLKKISFSNDLGHPICSNLREGNWLMDYISS
RLLKHPDTKDVGNLYADWFSILQKLPRYLIPMYFELIISLTYQKLLHACWKNMSSFVAEG
SSFVKSLSLGTVALCGVVKGAALPRVHPDVPGVCSTSVDKDVQDCSSISAGLPHFSSGVM
RCWGRDTFIAMHGLQLVTGQYDDARNIILSFAGCLRHGLIPNLLGEGKISRYNCRDAVWF
WLQCIQDYCEAKGFELLGMPVARIFPEHDSEPTPVGAKSQPLSDIIQEAMQRHVDGISFR
ERNAGSGIDSNMSDEGFLVEVGVDKTTGFVFGGSKFNCGTWCDKMGESEKAGTRGVPATP
RDGSAVELVGLCKSTVRWLEAAHNSGKYAYDGVFIKTCDGSVNKLTWAKWNEQIAKNFEK
YFYVGDEDTSHLVHKRYIYKDTHGASYSWCDYQLRPNFPIAMVYAPELFDAEHAWKALQI
IQDKLLGPLGVKTLDPDDMQYRGDYDNSNDSDDKSIAKGFNYHQGPEWLWPVGYFLRAKL
YFAKKLGSKKLEETIRFIRSYTVNHQLHLENSQWCGLPELTNSNGSHCHDSCPIQAWSHA
TLLDLLYDMKDL
NT seq 4539 nt NT seq  +upstreamnt  +downstreamnt
atggcctcaactagcaacaattctgttgatcaaataagaattttaaaactagtagatgga
aaacactgtgaaaacacattatatcggcttcaaaagggttggaccattcgttttatgttg
ggaccagatttggcttctcaaaaggttacagtttacacaaatattcctccatcagaacaa
ccatttaagcgcacagtctattatcccttatcttgggaacttctaacaaaatcggggatt
aattcacttgatgcttatgctcctgtcaagctttctcattctggtgcctttcagtattac
tttacatacaatgacaaaaaagctggaagtggttattttattgtggatccaacactgtgt
atagggatggacaaccatgttttacccctggatgctgtttgcatgcaaactctgctgcct
aaatctctaggacaattctgtgattggaaggacaggctcttagttgccaaagagagtgga
tacaatgtcttacacttcaccccaattcaaaaacttggatgttctaattcgtcttattca
gtatccgatcaaatggctgttaatccaagtttctattcatcggtacctgtaacattcaat
gatgtcgaaaacttagttgaagaaattcgtcgagattgggaaatgttaagtgtgactgat
gttgtatggaaccacaccgataagcatagctcatggttaaaaacttatccagaatctgcc
tataacttacacaattctccatatttacgaccagcgtatatacttgatcgtgcaattttt
catttaacacttgatattgaaaaagggaaaaaatatgcttcatattttccacttagtatt
attgaaacagaaaaggatttggaaagtttaaaagttattctactaaaaaatgtattacct
ggcttgaaattgtgggagttttaccaggtagatgtgccaaaacaggttgaacattttaca
caagctgtaaaatcatttaaacagaatggcaatgtaactaaggatgtcaaaataaaaatt
atccaagatcccaactttaatcgactacagtgttcagtggatatccaagctgcagtggag
cagttttatgctggaagtgattgtgatctagatcgagctgttagttcctttgtaagcacg
ttggaatggctgaatcgtgttaaaaaagaaaccgtgatgtctgacctcttcagtgctgtg
aacaacattattgctggtgtaaggtatgaacgtctagctgctgatggtccgaaagtggtt
cttcttaataagcaacatcctttaaccacaatgtattttcaccatcagtttgaagactca
actgtggatgaagaagaacaatttgtgttcggcgacacaaagaactctaagtttatcatg
gctcacaatggatgggtgatgggagcaaatgctttggaaaattttgcagaataccctgga
aaagtatatttcaggcgtgaacttgtttgttggggcgacattgttaaactcagatatgga
tcctccccatctgattgccctcctttgtgggaaaggatgaagcaatacacagaaatgaca
gctcgcatttttcatggcattcgaattgacaattgtcactccacgcccatccatgtagct
gagtacatgttagatgcagctcggaaaattcgtccagacgtttatgtgtttgctgagttg
tttacaggttctgaagaggttgacaacattttcgtcaatcggttaggtttaacttctctg
attcgtgaagctttaaatgcttgggatgcacatgaacttggacgacttgtgtatacttat
ggaggagaagctatttcctcctttattcaacctgcaacacagatactacaaccttccaga
gctcatgcattattctatgacattactcatgacaatgaaagtgtcattgtaaaacgaagt
attcgtgatgttcttcccttctctgctttggtaagcatgtcatgttgtgccattggaagc
aacagagggcatgatgagatgacaccgcatcacattaatgttgtcaatgaaaaacgcaag
tatagaaagtggaatagtgctttaaatagtggcagcgagtttgtgggaataaaatctggc
atgatacagggaaaacacttgcttaatgttttgcatcaaaccatggcaatgaacggcttc
actcagatctttgttgatcagcgtacgcaagatgtggttgctgtgactcgacataaccct
caaactcattacagttacatattggttggcaacacatcgttctccgattctaagatgaaa
ccagtccctccaatgttggttgaaggatctattatgggaattcctctagaagcaaaacca
agtgaaactgagcagtccacccaggactatttaaaaggatttactaaagataagcaattt
attaatggaattgataattacaatcttgtggtagatactgacattgcagcatctaatagt
acttgctgtaaaatacttgaatctgaagacaagtcatcacagactgttcacttcactcat
ttcccaccaggaagcattgtggttcttagggtcaaagttacagaaacagtaaacaaatca
atttctgatatccgtgaaaccattgcttctctccacaacagcaacacccattttgataaa
ttagtttcaaaattgaatttaagaactttgaaccgagttttgtttcgatgcaacgaagaa
gaaatgtctgacgggtttggcatctctgcttaccaaatcccaagttggcaaaagctttgt
tactgtggaattgcaggtattgctatccccttaaaaaaaatcagcttttctaatgacctt
ggtcatcccatctgttctaacttaagagaagggaactggttgatggattacatttcatcg
cgccttctaaaacatcctgatacaaaagatgtgggaaacttgtatgcagattggttttca
atattgcaaaagctgccacggtatttgataccgatgtattttgaactcatcatttcattg
acgtaccaaaagctattgcatgcttgttggaaaaatatgtccagttttgttgcagaagga
agcagctttgttaaatctttgtcactcggtacagttgctctgtgtggtgtagttaaggga
gctgcccttccaagagttcaccctgatgttccaggagtttgctccacatcggtggataaa
gatgttcaggattgttcctcaatttctgccggacttccacacttcagctcaggtgtaatg
agatgctggggtcgagatacattcattgcaatgcatggccttcaacttgttactggtcag
tacgatgatgccagaaacattattttaagctttgctggttgcttgagacatggcctcatt
ccaaatcttctcggtgaagggaaaatttcccgttataactgccgcgatgctgtgtggttt
tggttgcagtgcatacaagattactgtgaagcaaaaggttttgaacttcttggcatgcca
gttgcaagaattttccctgagcatgacagcgaacctacaccggttggggcaaagtctcag
ccgcttagtgacattattcaggaagctatgcagcgccatgtggatggaatatcattccgt
gaacgaaatgctggcagtggaatagacagcaacatgtcagatgaaggttttcttgttgaa
gttggtgtagacaaaaccactggttttgtttttggaggaagcaagttcaactgtggaaca
tggtgtgataagatgggggaaagtgagaaggctggaacaagaggagttccagctactcca
agagatggatctgctgttgaattggttggattatgtaaatcaacagttagatggttggag
gcagcacataactcagggaagtatgcgtatgatggtgtcttcatcaaaacgtgtgatgga
agtgttaataaacttacttgggcaaagtggaatgaacagattgctaaaaactttgaaaag
tatttttatgttggagatgaggacacttcgcacctagttcataaacgatacatctataaa
gacacacatggtgcctcttactcttggtgtgactatcagcttcgaccgaattttccaatt
gcaatggtgtatgctcccgaactgtttgatgctgaacatgcttggaaggctttgcaaata
atacaagacaaactgcttggaccacttggagtgaaaacattagatccggatgacatgcag
tacagaggagactatgataactcaaatgactcagatgataaatcgattgctaaaggtttc
aattaccatcaaggtccagaatggttgtggcctgttggttatttcctacgtgcaaaactc
tactttgcaaagaaacttggatctaaaaagctcgaagaaacaattcgatttattcgtagc
tacactgtaaaccatcagctacacttggagaactcacaatggtgtggattaccagagtta
acaaacagcaatggtagtcactgtcacgactcatgccccatacaagcttggtcgcacgcc
acattacttgatttgctttatgacatgaaggatctttaa

DBGET integrated database retrieval system