KEGG   Ciona intestinalis (sea squirt): 100181764Help
Entry
100181764         CDS       T01056                                 

Definition
arginase, non-hepatic 2-like
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    100181764
  Amino acid metabolism
   00330 Arginine and proline metabolism
    100181764
Enzymes [BR:cin01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     100181764
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 359 aa AA seqDB search
MSLYKQQLRRFAREIVKPCKHKESCTSQKRLLTNNPLPGDVVKVGVLGVPMHFGQGKPGV
RNGPKAIRDAGLLQRLSDHVGLEVNDYGDLDIAHGAHVDDVSKDGNWTIKNSRACGTANK
KLADAVYNTLQTNDICVNLGGDHSMAVGSIFGHSQARPNLSVLWVDAHPDLNNPTTSPSG
NIHGMPLHFLLKDLENKRTPISDFDWCKSCVSSPNIGFIAIRDIDPGEIAIMKRYNIPHC
SIREIDRNGIAHCMEKILDMINPSGNRPLHVSFDIDSVDPGIAPSTGTPVRGGLSYREAM
YVTEEVARTGSLSAFDLVEVNPELDPKRAEATAEVAVDVITHALGLSIRDTDYRRFPHS
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgagtttatataaacaacagctacgtcgattcgcaagggaaattgtaaagccttgtaaa
cacaaagagtcatgtacgtcacaaaaacgattattgacaaacaatcccctgccaggtgac
gtggttaaggtcggcgtgcttggcgttccaatgcatttcggtcaaggcaagcctggtgta
cgcaatggaccgaaggcgatacgcgatgctggtttgttgcaacgattgtcggaccatgtt
ggtttggaggtcaacgattatggtgacctcgacattgcgcatggcgcacacgtggatgac
gtcagcaaagatggaaattggacaataaagaattcgcgcgcgtgcggtactgccaacaaa
aaacttgctgatgccgtatacaacaccctacaaaccaatgatatatgtgttaaccttgga
ggtgatcacagtatggctgttggttcaatttttggtcattctcaagcgaggcctaacctt
agtgtcttatgggtggatgcacatcccgacttgaataacccaaccacgtctccatcaggc
aacatacatggaatgccgcttcactttttactcaaagatttggagaataagagaactcca
atttctgactttgattggtgcaaatcatgtgtaagttctcctaatattggatttattgcc
attcgtgacattgaccccggggaaattgccatcatgaagagatacaatattccccactgc
agtataagagaaatagacagaaatggaattgctcactgcatggaaaagatactggatatg
ataaatcctagtgggaatcgtccacttcatgttagtttcgatatcgattctgtagatcct
ggtatagcgccatctactggaacaccagtgcgtggtggattgtcatacagagaagcaatg
tatgtgacagaagaagtagcaagaaccggttcactcagtgcttttgacttggttgaagta
aatccggaactcgatccaaaaagagcggaggcgactgcagaagtggctgttgacgtcata
acacacgcactaggtctaagcatcagagatacagattatagaagatttccccacagttaa

DBGET integrated database retrieval system